CAZyme Information: KID66662.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID66662.1
• CAZy Family: GH31
• CAZyme Description: cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		56290.43	8.8376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000005:1504507-1506003(+)

Full Sequence      

MRGGLRLSGPYSGDAAWAANRFPRDGHGDRWNEPEPERPLFSLPATRAAARIEAPGIGQG
GDGGIVWMKQKQRAWPLWRFVLRRPRRWIFLGVVLLLGCFVGYFYRSEVAISAVWIPDME
SVSFGKKPLPAPLERTQITNYTLPLVTKGRHIVDAEGRRFKLASINWYGASDELFVPGGL
DVQHRKVIAQTIKKLGFNSVRLPYADELVSKNPVIDARLVRANADLVGLRALDILEAVAT
TLTEQGIAVIVNNHITRATWCCGANPCDAAWANDHLLGICKVTQSEDEWIRNWETVMTRF
TNDPLVIGVDLRNEVRGLWGTMPWHKWAETAERCGNRLLAMNPDWLVVVEGTESANDLRG
ARRRPVKLDIADRLVYSAHVYAWSGWGSLGGRFSKRTYESFRESMRGHWGYLLEEGVAPV
WVGEIGAPRLPASVGDVRYWKNLWRYLGEVDADFGYWALNPRKPKGNESEGYSLVEDDWV
GVVLDYRMMSMVEAMRRE

Enzyme Prediction     

No EC number prediction in KID66662.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	152	467	4.3e-157	0.9968253968253968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.85e-25	186	461	27	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.38e-15	136	486	21	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI73074.1|GH5_24	0.0	1	498	1	498
UNI14888.1|GH5_24	1.35e-213	43	497	52	513
UKZ59514.1|GH5_24	2.80e-213	7	497	11	505
UKZ85745.1|GH5_24	2.28e-212	39	497	52	505
QYT00999.1|GH5_24	1.12e-205	71	497	66	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	2.39e-45	147	479	8	336	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	4.63e-45	147	485	8	342	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
4TUF_A	1.04e-24	146	485	3	335	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]
3VVG_A	2.98e-24	151	482	19	364	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	7.04e-24	151	482	52	397	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	2.13e-44	147	479	41	367	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	5.44e-43	147	479	49	377	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	2.12e-32	140	479	26	379	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P10474|GUNB_CALSA	7.16e-24	145	478	630	986	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	1.01e-23	145	479	46	398	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998790	0.001259

TMHMM  Annotations     

Start	End
88	105