CAZyme Information: KID66460.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID66460.1
• CAZy Family: GH3
• CAZyme Description: Glycosyltransferase, DXD sugar-binding motif protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	AZNF01000005|CGC1	37813.66	8.4635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000005:825201-826187(+)

Full Sequence      

MPLHSPLRPPTSRSRPIFYVIPVILFIAVLLFQDVIYQTWALISLNMHWRANAADFILSA
ERDNFDVSFANYTRNQRNAGEPYQDVVPPVLHHIALGTRREDWRPQWEEALQSCVDLHPD
WETRLWTDDDAVAFIEQKFPELKDMWDSYPYAIERIDALRYMILYEIGGAILDLDVRCRR
ALGPLRRFGFVAPEAHPTGFSISFLIASRHNPFVGTILDNLPAFNRRWFGLPYAAVMFST
GGHFASVLHTLQPNRKDYKILPGPLHSLNGRVVTPLFEHLGSSSWHSYDAQLITMLGHAH
LMPIFFGVGIALALYVRRRIIIRRLRLS

Enzyme Prediction     

No EC number prediction in KID66460.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	106	185	2.4e-18	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.64e-20	105	298	97	294	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.39e-13	107	185	4	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI73314.1|GT32	1.48e-244	1	328	1	328
UNI24121.1|GT32	6.19e-154	10	326	12	326
QYT03157.1|GT32	4.46e-147	13	324	17	327
UKZ97012.1|GT32	1.20e-144	13	324	17	327
UKZ64181.1|GT32	9.49e-144	12	324	15	326

PDB Hits     

KID66460.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	5.34e-35	87	307	57	276	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.85e-34	65	326	44	303	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	6.30e-34	82	296	50	262	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	7.91e-32	86	296	61	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.29e-29	79	293	77	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999385	0.000641

TMHMM  Annotations     

Start	End
15	37
229	251
294	316