CAZyme Information: KID66268.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID66268.1
• CAZy Family: GH27
• CAZyme Description: initiation-specific alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		47047.16	8.4751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000005:105503-106738(+)

Full Sequence      

MPSLRARLSPKKLSSITLPKKMQKCLAMYLGCVLLLVLLLNLDVLFLLPSPSSIMASPAP
PPAKLPGSTFPQKIWQTWKIDPLLFGITETARAMTWIKQNPHMRYEVITDASDVTYVEQH
FGPDGFNRPDIVDFYRQLNLRIIKADLLRYMILYAEGGIYADIDVEALRPFHRFIPDRHN
EHDYDLIVGVEVDMPQFRHHRILGQKSQSFCQWTIAARPRHPVMLHLIESIIKWLKGVAR
RQRVALGKVELDFDQVITGTGPSAFTAAVLDEMNREARAKGEPAVTWDDFHAMDESKVVG
RVLVLTVEAFCAGQGHSDSGNHGSRGALVKHHYHASNWPSRHRRYRHPAYGQVEECNWDA
ACVEQWDRDVAAFDKLSEAERKKIIVERLKLLQEQQQEQQQPQQQQQVKSP

Enzyme Prediction     

No EC number prediction in KID66268.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	95	176	1.7e-18	0.8777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.14e-21	69	235	81	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.11e-11	95	177	10	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI73369.1|GT32	1.45e-281	1	411	7	418
UNI21646.1|GT32	7.51e-209	7	390	19	398
UNI24717.1|GT32	1.81e-192	12	389	25	413
QYS97060.1|GT32	1.71e-180	9	385	7	384
UPL04319.1|GT32	2.81e-180	19	390	60	430

PDB Hits     

KID66268.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.51e-30	71	338	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.55e-28	70	310	99	348	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.00e-25	70	310	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.02e-19	71	231	97	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000006

TMHMM  Annotations     

Start	End
26	48