CAZyme Information: KID66257.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID66257.1
• CAZy Family: GH27
• CAZyme Description: Glycosyltransferase, DXD sugar-binding motif protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	AZNF01000005|CGC7	37220.81	8.2951

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000005:71881-72858(+)

Full Sequence      

MHKSSYIRNQSGGKFRQILLAALVILIVSMWFGRHLLYTTWTLAALRIFWHDNASDFILS
ESHDNFDVSFANYSIHQVSAEPYEDVVPPILHHIALGDNEGRWKGRWGEAVQSCLDMHPG
WESHIWTDDKASQFVSDKFPELRELWDNYHYPVERIDALRYMLLYAYGGVILDMDLKCKR
ALGPLRRFSFVAPEAHPTGFSIGFMMASKGNAFVGDIVRNLTVYNKEWLGLPYATVMFST
GCHFASVIHAYESNRTDLKILPGPLHSLNGRVSTPIFDHLGSSSWHSYDAKLIVTIGSRI
NLIFFFFVGVALALFLRRKSLLRRF

Enzyme Prediction     

No EC number prediction in KID66257.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	107	185	2.9e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.75e-25	36	321	24	314	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.14e-14	106	185	3	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI72858.1|GT32	5.56e-243	1	325	1	325
QUC17233.1|GT32	7.55e-216	1	325	1	325
QPH09562.1|GT32	1.25e-214	1	325	1	325
ANH56537.1|GT32	1.00e-204	1	325	1	325
UKZ64181.1|GT32	1.13e-167	34	324	36	326

PDB Hits     

KID66257.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.56e-34	80	300	48	266	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	9.15e-34	66	324	44	301	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	9.98e-33	87	293	57	262	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.02e-30	86	300	61	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.94e-27	74	294	72	290	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999843	0.000181

TMHMM  Annotations     

Start	End
15	37
229	251
293	315