CAZyme Information: KID66082.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID66082.1
• CAZy Family: GH24
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		44207.74	4.7003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000006:1929214-1930655(+)

Full Sequence      

MTFPVQTWPSIASILALLPATLAGFNSGSGKNAKIRTIKAVVRLPNSAWVITAPVGNTNP
ELLDSKQMLTLLSLDTEIDVIPVAFMNGITPPITNFANAGDNCTAFPSNSNLLSCPQIEA
DIKSCQATNGKTIILSLGGATYGQGGWSSVSAAQEAAQNVWDMFGPVPSGKAIDRPFGSA
VVDGFDFDFEASTNNLPAFGQKLRSLMDAAGGKKFYLTAAPQCVFPDAAVGAALNAVSFD
FIMIQFYNNWCGVSNFQEGSATQNAFNFDVWDNWAKTTSPNKNIKLLIGVPAAPGAGGGY
TSGSKLKAAINWSQKYSNFGGAMMWDMSQLYANSAFLGEIVSDISNGPTTTLPPGGTTTT
TTTTTTATTTTTTTSSTTSPPPTGTLVPQWGQCGGEGYTGPTQCQPPYKCVYGGQWWSSC
Q

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	78	298	2.4e-25	0.6047297297297297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	3.37e-96	75	342	22	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
119350	GH18_chitinase_D-like	1.10e-15	79	327	29	295	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
395573	Glyco_hydro_18	1.11e-14	96	305	30	232	Glycosyl hydrolases family 18.
197593	fCBD	3.59e-11	388	421	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	6.45e-11	389	417	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64291.1|CBM1|GH18	7.18e-247	1	421	1	405
UNI24677.1|CBM1|GH18	1.52e-201	14	421	1	384
ATY58486.1|CBM1|GH18	4.37e-185	10	421	9	406
QUC17538.1|CBM1|GH18	3.67e-173	10	421	9	401
AIT18869.1|CBM1|GH18	4.36e-166	10	421	9	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	1.58e-54	65	333	19	272	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2XVN_A	2.76e-36	75	326	22	285	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	2.82e-36	75	326	23	286	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	2.82e-36	75	326	23	286	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2GSJ_A	7.76e-29	80	326	27	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12713|CHI33_TRIHA	5.99e-133	10	342	6	318	Endochitinase 33 OS=Trichoderma harzianum OX=5544 GN=chit33 PE=1 SV=1
sp|D4B4X4|CHI33_ARTBC	3.29e-81	77	347	39	314	Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03514 PE=1 SV=2
sp|P29026|CHI1_RHIOL	2.64e-59	77	350	57	317	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1
sp|P29027|CHI2_RHIOL	1.46e-58	77	350	57	317	Chitinase 2 OS=Rhizopus oligosporus OX=4847 GN=CHI2 PE=1 SV=1
sp|P40954|CHI3_CANAL	3.52e-55	65	344	36	306	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.431765	0.568233	CS pos: 24-25. Pr: 0.4021

TMHMM  Annotations     

There is no transmembrane helices in KID66082.1.