CAZyme Information: KID65993.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID65993.1
• CAZy Family: GH2
• CAZyme Description: Lipopolysaccharide-modifying protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	AZNF01000006|CGC12	73266.89	6.7678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000006:1658450-1660339(-)

Full Sequence      

MFQASPTIAPFLRRRQLLRFLFLAGSLYLVFWFWLPCLERLKTTEWMRHHAEARPRPKLN
HSAPKNHPIDNLIRDANARLDNLLEKRSFTLQESAARYRERRGRHPPPGFDQWFAQALKD
EAIVVEEFFDRIHHDINPFWAMDPRELRTQANTHPQVIRVRNGQVTFETDDPERVPWINL
WAKLVEEMMPHLPDLDMPINVMDEPRVLVPWEQINEYVGTERANRRLLDPQNTTDTFGTF
KHVAEPKEHLYDPGWITDDAHRYWDHVRATCSPDDPSRTVSSLDSFDGPVDFPTEPTRYM
FHGYVQNFSQAQNPCTQPHLRGMHGAFVESISMSTTHSLFPLFGGSKMPQNNELLIPGAM
YLSPREFYNGGKDHGPAWADKKDGLIWRGTASGGRNKHDNWWHFHRHRWVQMMNASVLTA
LERGDPTAAKTFKLPPRERYAVKAQADGRLGEWLSSLSDAAFVHLECFPAVEDRVGTWPF
GHDEVRKTCAYTSPFMEVRPSLPMKEQYGYKLLPDVDGNSFSGRWRAFLQSTSLPLKATI
YTEWHDDRLVPWVHFVPFDNTYQDIYGVLDYFLARDDEAEAIAGQGKDWAERVLRRQDMK
LYVWRLLLEYARVLDDARDSLAFVGDLLK

Enzyme Prediction     

No EC number prediction in KID65993.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	328	614	2.4e-64	0.94

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.25e-13	478	614	122	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.84e-08	503	614	209	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64228.1|GT90	0.0	1	629	1	629
UNI18326.1|GT90	1.67e-293	4	627	10	637
UNI18357.1|GT90	1.68e-273	39	624	58	635
ATY67467.1|GT90	5.48e-272	54	627	50	618
QDS69583.1|GT90	1.56e-206	54	629	60	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.93e-06	510	625	272	393	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.46e-40	67	620	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	4.36e-06	510	614	282	389	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000003

TMHMM  Annotations     

Start	End
17	36