CAZyme Information: KID65954.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID65954.1
• CAZy Family: GH18|CBM24
• CAZyme Description: glycosyl transferase, group 2 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	AZNF01000006|CGC15	74931.60	8.9948

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000006:1533924-1535897(+)

Full Sequence      

MSSATPKLGRDSCEQDESELRVTRPQAALLPCEKSQDSPLLSDRDSTHGPDGGGVLASSE
IFAAKHDHDARPSSEDRVEHVQPWPQKPNQAKYTDFKPFHATSSNSPRYMVRNIMNKTKK
LPFEQPTLDDAEFETLTRLMDDKQKHTVPSFKAKMAFRAFYFLLLAALIYFVLVGWPLWP
GTVVWFWRWYQGQVGQHHIAGLVAFLAAGMIRNILPQFLCTFQVSRQEPREAEESAVSQC
CVIIPCYKAAETLRTTLPACLAIFGPKQIFVVANGNSTVPLDNTADICDEFGVRHFWLPV
GSKITAEFVGVTLGKEFQYCLLIDDDVLLPPSLPILTKWFNGPGHENVACVGYTIKSVGS
NSSRGTIVQQAQDLEYKIAGLTKVFQSKYGSTVFPHGAIALWRRDVLEKILRAHPGYSIS
EDWWLGHTARAAGYRILMSSSVFVETETPPRLFPDWFFCRAKDSRGGYGEMSVVQQRFFR
WSFFYLFRIWANTLYLIFSWRLGWRVLITKLYVLGEIYDTLIKLFTPVFLPVAMIAHWRL
TLILWFGTILANFVLSIWFNVVHLSLLRRGSPKNERVSWLAFPAFFVIKFVMTFVTVASV
YWTIYQYAVFFARQHLRVTESVPAWKVIREKKENMAEKEPELSGVASKVSETNSCRK

Enzyme Prediction     

No EC number prediction in KID65954.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	240	451	2.3e-23	0.9217391304347826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	4.32e-24	242	453	6	218	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.97e-22	242	633	58	436	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.00e-16	242	422	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	9.64e-13	321	537	3	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
395426	Glycos_transf_2	2.08e-09	241	407	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64086.1|GT2	0.0	1	657	1	657
QRD00921.1|GT2	5.49e-148	3	624	10	612
CAE7014388.1|GT2	1.32e-119	71	636	167	741
UPL00273.1|GT2	1.44e-114	154	628	194	653
CAK44102.1|GT2	4.44e-114	83	628	141	655

PDB Hits     

KID65954.1 has no PDB hit.

Swiss-Prot Hits     

KID65954.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

Start	End
157	179
194	216
481	503
513	535
542	564
579	601