CAZyme Information: KID65615.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID65615.1
• CAZy Family: GH18
• CAZyme Description: Glycosyl transferase, family 25

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		46297.66	7.5068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000006:353865-355167(+)

Full Sequence      

MSTIESIVAFSRSHVSSLSCRSPLFRLLVTALIFFSLSTLFIFATGPVADRSALWLPSTR
TNGQNGPSAMDREHHPPVVPTADNDAGNSTLGFSSIYFIYLPSRYDRLDAMSLQSYLSGV
DLTEYPAVGPQLIKDVGMPPTRKPGKLRTSEQGCWRAHANIWSTMLRQKLPPLLIVESDA
TWDINIRKIMPNLNKHFRQFLREINSTQLHNPAWPAEAVARNESTKASNDDPWLSSHWDI
LSFGQCHETDENNDIRLIYNDPFVPLGKDYQGRALTHERVIRRSGGITCTTAYAVSQTGA
AKLLLRTAVNLDMPVDMVMQEMIVSGDLVSYSVMPPIMAQWQYAEGIGMEERGANSNINK
AGIFSGLFSLFARKKAWENVKASGSVWTTKTYHEDVAFDEMSLQGAWKRVFGTGN

Enzyme Prediction     

No EC number prediction in KID65615.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	94	319	8.8e-25	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.65e-15	96	185	2	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	1.57e-08	93	319	1	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	3.04e-06	151	340	68	209	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64049.1|GT25	1.52e-300	1	415	1	418
QLI72726.1|GT25	1.61e-141	25	415	9	390
QLI71971.1|GT25	2.54e-117	86	410	65	386
ATY66624.1|GT25	1.34e-110	86	412	78	405
QBZ65590.1|GT25	7.06e-75	86	412	75	384

PDB Hits     

KID65615.1 has no PDB hit.

Swiss-Prot Hits     

KID65615.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000024

TMHMM  Annotations     

Start	End
24	46