CAZyme Information: KID65222.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID65222.1
• CAZy Family: GH18
• CAZyme Description: glycosyltransferase family 25 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	AZNF01000007|CGC3	44966.90	6.9450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000007:1486649-1488045(-)

Full Sequence      

MKTESNTMLGFLGRRVLWPLGILIFISALFTLQRRHFTDGPSIAHSRSSDKSDNLRHVFN
STLGFQDILVVGLPSRTDRRDGMILGAALSGLNINFIDGVKGEDVYEKAIPVPEDRNNHL
KGPGLGSWRAHMNAIHDVVRRNLSSALIMEDDVDWDVRIREQLHDFAVSSRALTQPLRHQ
PGQYADPTYPNPVEGSPKKVPDMNFHSLPDTVQPIMSPYGDNWDVLWLGHCGMHFVFEHS
NLIAKGRVVKENDVSVPPKKNLWSINKPFSLVEEYPAHTRVVHHAQEGVCSLAYAVSQRG
AQKMLREIALKPATDAFDILLRFYCEGTHGRTKQECLSVNPSLFSHHRPVGPIGASSDIG
DHGEGYRHEASTDMVRFSVRLNAEVILNGSTNYIDQFPDSAE

Enzyme Prediction     

No EC number prediction in KID65222.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	65	318	1.2e-23	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	9.67e-18	68	156	2	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	0.005	65	153	1	96	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI69289.1|GT25	1.38e-296	1	402	40	441
AEO55058.1|GT25	1.58e-156	12	399	9	397
AEO68754.1|GT25	3.07e-155	19	402	11	395
AEO67124.1|GT25	5.35e-148	58	399	4	348
UQC78773.1|GT25	4.04e-147	60	399	6	325

PDB Hits     

KID65222.1 has no PDB hit.

Swiss-Prot Hits     

KID65222.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

Start	End
12	31