CAZyme Information: KID64653.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID64653.1
• CAZy Family: GH16
• CAZyme Description: Glycoside hydrolase, family 35

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		70050.70	4.9252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000008:1615216-1617153(-)

Full Sequence      

MLVRGAAAAAAVFGWAAALLSLAKPLVAAHRGNFTYDRHNFLLDGVPIQLIGGQMDPQRI
PPAYWTQRLQMAKAMGLNTIFSYVFWNNIEPTEGSWDFEGRNDIARFVRLAQQEGLYVVL
RPGPYICGEHEWGGFPSWLTQIPGMAVRQNNKPFLDASRNYLEQLGKHLAATHISQGGPV
LMTQLENEYGSFGKDKAYLRAMADMLKANFDGFLYTNDGGGKNYLDGGSLHGILAETDGD
PKTGFAARDQYVTDATMLGPQLDGEYYVTWIDDWSSNSPYQYTSGRPDATKRTLDDLDWI
LAGNNSFSIYMFHGGTNWGFENGGIWVDNRLNAVTTSYDYGAPLDESGRATDIYRQIRDV
ISKHVPAGTIPEVPHVPGLTTIDDFALEPAVALFDTRSDKPAVQAGSPVPMEKLGQAFGF
VLYEHRVSAAVSGAIAPGDGPRDRVMVYVNGARVGVVDKTHAAPAPVSVDLKQGDVLQLL
VENLGRIDYGQQLREQQKGIVGNVTVGGDAVLEGWSAYSLPLTDLPAALADENSETPEIK
DGSAPVFYKGTFGLPAGVGNDLSGDTFLSLPNGVKGSVWVNGHHLGRYWVVGPQQSLYVP
GAYLYGGNKPNHVVVLELEPKAGTDMVARGLATREWANHPDPDVA

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	41	362	2e-95	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.29e-106	40	362	1	316	Glycosyl hydrolases family 35.
166698	PLN03059	2.82e-56	19	589	15	659	beta-galactosidase; Provisional
224786	GanA	3.65e-38	34	641	1	610	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	1.16e-08	57	190	4	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
404274	BetaGal_dom4_5	2.94e-04	546	616	35	104	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI69147.1|GH35	0.0	1	645	1	643
UNI19525.1|GH35	3.58e-301	1	643	1	634
QKX60376.1|GH35	5.97e-289	19	643	20	648
ATY64919.1|GH35	5.19e-265	13	597	3	588
QRD02051.1|GH35	1.15e-190	28	643	31	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	3.25e-118	33	618	17	578	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
6EON_A	2.60e-107	32	618	26	593	Galactanase BT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	4.58e-102	32	617	6	572	Crystal structure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3THC_A	1.47e-100	36	619	13	599	Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	2.68e-100	36	619	37	623	Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48982|BGAL_XANMN	2.54e-108	20	599	13	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
sp|Q3UPY5|GLBL2_MOUSE	9.83e-104	40	617	53	613	Beta-galactosidase-1-like protein 2 OS=Mus musculus OX=10090 GN=Glb1l2 PE=1 SV=1
sp|Q9TRY9|BGAL_CANLF	3.17e-103	19	619	18	623	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
sp|O19015|BGAL_FELCA	4.89e-102	19	640	18	644	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
sp|Q60HF6|BGAL_MACFA	7.26e-101	19	619	17	622	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004735	0.995246	CS pos: 29-30. Pr: 0.8505

TMHMM  Annotations     

Start	End
7	29