CAZyme Information: KID63933.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID63933.1
• CAZy Family: GH13
• CAZyme Description: chitinase 18-4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		43005.52	5.1098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000009:1122554-1123808(+)

Full Sequence      

MASSTHRPFATRCVMYLTGQHNVVPSEPELTKQITHVVLAFMRSDVFNSDQQSPEFPLFT
TVGEVREKFHHETKVMVAVGGWGDSKGFEEANKDAKSRKRWCENVRKMIDLTGADGVDID
WEYPGGNRDDYKIIPNERRKWEIEAFVQLLTDLRVAIGSDKLLSIAVPGLERDMMAFTEE
TVPRIVKQVDFINVMTYDLLNRRDTLVKHHSGVSASLESIESYIARGASAPVLNLGLAYY
VKWAMTEECDPDHPLSCPTQLLEDPETGADLGRTAAFSWHDKIPEELEQSFSRAMTNGKY
FEDGSFGYLDVKEARWWTFDTPNVIHRKFKDIVKQRRLGGVFAWGIGEDAPAFSHLSATL
HELQNLTKDDLGEAASKDEL

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	24	351	2.6e-46	0.8682432432432432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.29e-67	12	349	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	6.52e-45	32	349	24	334	Glyco_18 domain.
119349	GH18_chitinase-like	4.81e-42	13	199	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119365	GH18_chitinase	1.89e-40	32	349	24	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	1.28e-28	32	349	63	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI73536.1|GH18	2.43e-283	1	380	1	380
QUC18999.1|GH18	1.75e-201	12	366	29	383
AIT18907.1|GH18	1.12e-189	2	380	22	399
AIT18893.1|GH18	4.55e-189	2	380	22	399
AIT18924.1|GH18	1.03e-186	1	380	20	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NZC_A	8.08e-21	33	349	33	383	Crystal structure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]
4PTM_A	8.44e-21	33	349	33	383	Crystal Structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine, a hydrolyzed product of hexasaccharide at 1.7 Angstrom resolution [Serratia proteamaculans 568]
4LGX_A	8.65e-21	33	349	36	386	Structure of Chitinase D from Serratia proteamaculans revealed an unusually constrained substrate binding site [Serratia proteamaculans 568]
6HM1_A	1.12e-20	65	349	77	380	Structural and thermodynamic signatures of ligand binding to an enigmatic chitinase-D from Serratia proteamaculans [Serratia proteamaculans 568]
6F8N_A	3.11e-20	65	349	85	388	Key residues affecting transglycosylation activity in family 18 chitinases - Insights into donor and acceptor subsites [Serratia proteamaculans 568],6F8N_B Key residues affecting transglycosylation activity in family 18 chitinases - Insights into donor and acceptor subsites [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H2A0L4|CHI1_PINMG	1.06e-17	15	349	33	358	Putative chitinase 1 OS=Margaritifera margaritifera OX=102329 PE=1 SV=1
sp|P32470|CHI1_APHAL	1.47e-13	33	362	63	396	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|Q9D7Q1|CHIT1_MOUSE	4.01e-13	35	349	52	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|O14456|CHI1_METAN	8.64e-12	67	359	117	393	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	1.56e-11	67	360	116	394	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KID63933.1.