CAZyme Information: KID63746.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID63746.1
• CAZy Family: GH128
• CAZyme Description: cytochrome c peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		40827.74	8.2204

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000009:425233-426498(-)

Full Sequence      

MASATRQFARVATRTAARNAFAVAPRQAFRQQGRRWYSSEPAPQKGSSTWLYLTGAAAAG
GLGFWYYTASGSPSAASSKIVNPTKEDYQKVYDEIASRLEEKDDYDDGSFGPVLLRLAWH
ASGTFDKETGTGGSNGATMRFAPESDHGANAGLVAARNFLEPVKAKFPWITHSDLWILGG
VCAVQEMQGPYIPYRPGRSDRDVSACTPDGRLPDATQGSDHLRNIFYRMGFNDQEIVALS
GAHALGRCHTDRSGFSGPWTFSPTILTNDYYRLLVEEKWQWKKWNGPKQYEDKTTQTLMM
LPTDMVLVQDKKFKPWTEKYAKDNDLFFKDFSAVVTKLFELGVPFAEGTENQRWNMKPTW
DESK

Enzyme Prediction     

No EC number prediction in KID63746.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	91	343	6.5e-61	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	5.38e-150	84	346	9	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	2.79e-86	112	342	32	243	L-ascorbate peroxidase
166005	PLN02364	1.37e-70	83	342	6	246	L-ascorbate peroxidase 1
178467	PLN02879	3.20e-70	85	342	10	246	L-ascorbate peroxidase
173823	plant_peroxidase_like	3.11e-58	93	338	1	253	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI73446.1|AA2	8.57e-269	1	364	1	364
QUC18246.1|AA2	1.48e-243	1	364	1	360
QPH00465.1|AA2	2.08e-242	1	364	1	365
UPK98426.1|AA2	1.22e-216	1	361	1	356
QPC75741.1|AA2	2.84e-213	1	362	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V2E_A	3.73e-85	86	345	17	276	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	3.97e-85	86	345	19	278	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
4A71_A	5.62e-85	86	345	19	278	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	1.36e-84	86	345	14	273	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	1.49e-84	86	345	17	276	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4ING3|CCPR_GIBZE	2.05e-213	1	362	1	358	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	3.13e-194	12	357	13	354	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	4.20e-186	1	359	1	360	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	3.72e-163	3	352	7	354	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q4WPF8|CCPR_ASPFU	5.62e-159	29	352	38	359	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999889	0.000102

TMHMM  Annotations     

There is no transmembrane helices in KID63746.1.