CAZyme Information: KID63067.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID63067.1
• CAZy Family: GT8
• CAZyme Description: glycosyltransferase family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		59649.01	5.0729

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000010:18778-20389(+)

Full Sequence      

MAILRGPVEPRRMGLMLTKRLARTMVVVLALLLTVGIMLTRYMYDRAESVLPFHRQHTGP
AAYSFKSASRFSPVTFDDPEGMSRHDLCASFPSYLLNHVQPVLKIGHSENKERLDASFSS
VSSCFNTDDLLVISDLDEVVHGHQAIDVLADLPADYYNLDNNPSFRNYTAQKEMRNNGTL
NEETQTAIDGWILDKYKFLPMVERAWLAKPDKAFYFFYEADTYIFWDNVFRFLQSFDPDT
PIYMGSPSPGRHDDEQDVETWFANGGPGLVLSRGAIKALLHRETDANGHYVDPHVTEKWQ
DLVAGECCGDSVLGWALWNVTVQLQGYWPMFNPHPLHGIPFSDSYWCQPVMTLHKTTPKD
MIDLWHWEFGQRQLHRPMLYSDVWRLRHPGEPSTLENWDNGDWDSWQPPAEASVSGPGAC
EQYCRSQDDCLQWNWRGGDEKKCILMRSVRYGAARKPEYFPDDGKRETLPEDELDTQAQG
KWVEYQSGWVEDRIESWRNERTCEQVHWVGPSVSRVF

Enzyme Prediction     

No EC number prediction in KID63067.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.07e-05	221	279	94	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI67549.1|GT31	0.0	1	517	1	517
QPG94026.1|GT31	3.66e-290	1	517	1	517
ANH56540.1|GT31	8.19e-270	1	517	1	524
QUC22953.1|GT31	3.81e-264	1	517	1	517
UPL01669.1|GT31	6.58e-220	63	517	54	508

PDB Hits     

KID63067.1 has no PDB hit.

Swiss-Prot Hits     

KID63067.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000003

TMHMM  Annotations     

Start	End
21	43