CAZyme Information: KID62827.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID62827.1
• CAZy Family: CE5
• CAZyme Description: SUN domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		46483.13	6.3721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000011:917627-919007(-)

Full Sequence      

MRNLVHVAIAATLAIGVAANSHQHLHHHAKKDVASKVERRAADGIVWVPATQTVYVLDGV
EISVEQALAGLKNGDFVIAGESTPIFTPPLTQSPKPTTTTSLQDLGAQFLEKTSSAVSLP
NPTTTSQPPPPKSTQAPKPSPSPSTPPSGGIGLDSKFPSGQIDCSKFPSDYGAVPLDYLK
MGGWSGIQFVPDFSMGKSKSINNIVTGIHNSECTKGAMCSYACPPGYQKSQWPEAQGETG
QSIGGLYCNDGGKLELTRKSNPVLCEPGAGGVSIINECDEVVSTCRTDYPGTESMTFPAE
AMPGNSVALTNPDSSTYFFWKNLPTTAQYYVNNKGLAAQDACLWNCPCDENKSQEKKTCG
NWAPINIGVGQANDTNTYISIFKNSPTSSAKLNFNIEITINGNMKCAYENGNFIGESNGN
GCTVTKSEGAKAVIRYYS

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	141	436	4.4e-92	0.9075907590759076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.46e-133	159	423	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI74568.1|GH132	5.62e-291	1	438	1	438
QPG99169.1|GH132	4.75e-146	1	437	46	494
QUC20321.1|GH132	8.96e-140	1	437	1	457
CEF73471.1|GH132	3.88e-135	1	437	1	443
QPC75848.1|GH132	3.88e-135	1	437	1	443

PDB Hits     

KID62827.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	2.89e-88	9	436	6	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	1.19e-76	147	437	168	448	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|P53616|SUN4_YEAST	5.85e-64	156	436	162	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|O43015|YBOH_SCHPO	4.38e-63	154	429	56	312	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|Q59NP5|SUN41_CANAL	6.87e-61	156	436	160	417	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000330	0.999640	CS pos: 19-20. Pr: 0.9648

TMHMM  Annotations     

There is no transmembrane helices in KID62827.1.