CAZyme Information: KID62603.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID62603.1
• CAZy Family: CE16
• CAZyme Description: Glycoside hydrolase, family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833	AZNF01000011|CGC1	91215.59	5.9135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000011:190431-193036(+)

Full Sequence      

MADINIEEVLEKLTLAEKVDLLTGADFWHTKALPKHGIPSLRMSDGPNGVRGTKFFNGVP
AACFPCGTALGSTFNQQLLEEAGKKMGEEALAKSAHIILGPTINMQRSPLGGRGFESIGE
DPFLAGLGAAALVRGIQSTGVQATIKHFLCNDQEDKRMGVQSIVTERALREIYALPFQLA
VRDARPGAFMTAYNGINGTMCSENSKYLDRMLRKEWGWEGLIMSDWYGTYSTTPAVVAGL
DLEMPGPARFRGEALKFNASTNKPFTHVIDERVRAVLRLVKKVSGLDIKELGPEREANTP
ETAALLRKIGNESIVLLKNDNNVLPFKKDKKTLVLGPNAKVATYHGGGSASLPAYYAVTP
YDGIAAKLGSCPAYTVGAYTHRFLPLLGSQCIDPNGKQGMRWTVYNEPPGTPDRQSVDML
YFSKTDMHLLDYNNPKVADTWYADLEGSFVPDEDCTYELGLVVSGTAKAFVNNKLIVDNA
TKQVAGDTFFGAATREERGFVDLKKGEKYEFRIEFGSAPTFTLKGDASVPGHGSLRVGGC
KVIDEQEEIKKSVHLAKEYDQVIICAGLNSDWETEGADRVSMKLPGVLDQLITQVAAANS
NTAVVMQTGTPEEMPWLEKTPAVVQAWYGGNETGNCIADILFGDANPSGKLSLSFPKQLQ
DVPSFLNFRAEAGRTLYGEDVYMGYRYYEFANRAVNFPFGHGLSYTSFSFSDLSVTSSEG
KVTAALKVKNTGSTKGSEVAQMYIKPRQAAKIRRPVKELRGFAKVELEAGETKVVTITEL
EKYVAAYWDEERDQWCVEAGEYEVIISDSSVVRDGKAVRGSFKVSTSYWWDGI

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	245	1.8e-60	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.52e-73	64	815	120	760	beta-glucosidase BglX.
224389	BglX	1.09e-64	26	367	48	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.80e-54	314	705	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.82e-41	13	778	60	741	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.72e-35	64	279	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI74163.1|GH3	0.0	1	833	1	833
ANH56479.1|GH3	0.0	1	833	1	833
QUC20540.1|GH3	0.0	1	833	1	837
ATY62757.1|GH3	0.0	1	833	1	832
UKZ86562.1|GH3	0.0	1	833	1	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.47e-270	1	833	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.95e-263	5	833	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.51e-132	4	824	3	674	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.05e-111	5	818	4	658	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	8.02e-102	8	817	56	824	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DFA8|BGLI_NEOFI	2.39e-313	1	833	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	4.80e-313	1	833	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	4.80e-313	1	833	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	5.90e-309	1	833	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	7.02e-308	1	833	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999915	0.000109

TMHMM  Annotations     

There is no transmembrane helices in KID62603.1.