CAZyme Information: KID62155.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID62155.1
• CAZy Family: AA8
• CAZyme Description: Glycoside hydrolase, family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		55371.77	4.9438

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000012:20591-22226(+)

Full Sequence      

MGSKSSLLPADFEWGFATAAYQIEGAVAEGGRGESIWDTFCHLEPTRTKGANGDVACDHY
HRYEEDFDLLTKYGAKAYRFSISWSRIIPQGGRNDPLNEEGISFYSRLIDSLLKRGITPW
VTLYHWDLPQALHDRYGGWLDVQESQLDFERYARVCYEHFGDRVKNWITLNEPWIQSIFG
YSTGGNAPGRSSTNDQSDAGNSATEPWIVGKAQILSHVRAVIAYNKDFKPSQGGQIGISL
NGDYYEPWDSVDPRDKEAAERRMEFHIGWFANPIFLKKDYPSCMREQLGDRLPLFTESEI
ALLEEAETDFYGMNYYTSQFARHREELASDTDFVGNLDELQQDKQGTPVGEESGLHWLRS
CPDLFRKHLTRVYNLYGKPIYITENGCPCPGEDKMTCDEAVNDPYRIKYFSSHLDAICKS
IVDDGAIIKGYFAWALLDNLEWSDGYGPRFGVTFTDYKTLKRTPKQSALLLRKMVTDRQG
LSVTTS

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	477	2.3e-158	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.67e-165	8	476	5	449	Glycosyl hydrolase family 1.
274539	BGL	1.87e-164	9	469	1	424	beta-galactosidase.
225343	BglB	9.88e-144	8	476	4	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	1.22e-105	9	468	31	473	beta-glucosidase
215435	PLN02814	1.84e-102	8	468	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI67917.1|GH1	0.0	1	486	1	502
QUC16568.1|GH1	0.0	3	483	2	482
QPG94257.1|GH1	0.0	3	478	2	477
UNI22858.1|GH1	1.84e-313	1	483	1	482
QYS96282.1|GH1	3.09e-305	3	483	2	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JBO_A	3.86e-307	1	483	1	483	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]
6KHT_A	7.09e-303	2	479	14	492	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
4MDO_A	1.11e-179	5	474	23	491	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
3AHY_A	7.94e-176	7	474	8	465	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]
6EFU_A	1.02e-174	7	474	2	458	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	8.65e-176	8	471	11	467	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.70e-161	8	473	6	454	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	1.15e-137	6	475	19	479	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q8L7J2|BGL06_ORYSJ	1.56e-137	9	467	51	511	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	1.14e-136	9	471	23	507	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KID62155.1.