CAZyme Information: KID61472.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID61472.1
• CAZy Family: AA7
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		66889.57	6.5428

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000015:722647-724627(-)

Full Sequence      

MGRRHANPLHNPLHYAARQPPSGPPVTAAAAGRALPSYDYVIVGAGAAGCVLASKLSEDK
DVSVLVLEAGGDNTKVLECKVPLMFSKLFHGQHDWDYYTVEQEAVASRRLYWPRGRIIGG
SSSMNAMIYHHCSASDFDEWESVHGCDGWGYQDLAPHFRSVEKFTPNPARPAIDAAHRGD
AGKWQTGYSWLSQIVEDGFLPACDDAGIPPNSDINTKNGSLGVTRLQTFIDSKGQRSSLA
TAFLTPDVLRRPNLYVACGAQVTRVLFDRINTAEPTAIGVEFQVSRGGERYQVHAGREVI
LSAGAVNTPQTLMLSGIGPGDELKKHSIARVFANDNVGRQLKDHLCSNGVLCKSKKGSTL
DYLADDIKAIPALVQWLLFGTGPLTSNVGEAAAFVRTFEYDLPGLVPKDYTSGDKAPDLE
IIGAPIAFIHHGEERPLDDANVFSLAPIGLRPQSSGTIRLKSADVFDHPIIDPKYLTDKE
DNDKKVLIAGLRLCLKIMRSPAFQKYLDPVPTNDDPSSYWWPYSCSDPDAVTDEQLGRYL
VERAFTLYHPVGSARMGPSPSDSVVDTECRVYGTNGLRVVDASIFPEQISGHPTAPIAAI
AHRASEMIKQGRKTA

Enzyme Prediction     

No EC number prediction in KID61472.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	610	2.1e-169	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.21e-132	37	613	5	535	choline dehydrogenase; Validated
225186	BetA	4.22e-120	33	615	3	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.64e-60	39	608	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.36e-47	452	604	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.38e-41	104	346	13	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI70534.1|AA3_2	0.0	1	615	1	615
ANH22773.1|AA3_2	0.0	1	615	1	622
BCS23466.1|AA3_2	0.0	1	612	1	612
QMW44376.1|AA3_2	2.73e-317	1	615	1	621
UDD57318.1|AA3_2	2.73e-317	1	615	1	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	1.60e-88	38	608	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	4.40e-88	38	608	8	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	4.40e-88	38	608	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	6.59e-88	38	608	24	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	1.02e-87	38	608	84	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	1.83e-138	37	609	35	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|P64264|Y1310_MYCBO	3.63e-99	39	609	6	527	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	3.63e-99	39	609	6	527	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	3.63e-99	39	609	6	527	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|A0A248QE08|FAP_CHLVA	1.44e-86	38	608	84	636	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KID61472.1.