CAZyme Information: KID61418.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID61418.1
• CAZy Family: AA7
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644		71929.03	7.5134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000015:555274-557740(+)

Full Sequence      

MPTNQKQKEEKPALPVKVDVLIVGSGPIGAVFARELVNAQLKNREDLQILMVDVGPHVVK
GQLQPLSVPTGDNATRYIRNGQNPTQIASQNLAEAAASRVVGGMGSHWTCCTPRQHEHER
LKEFKAVYDNYERAEKLFNTTTTAFDHSVRQHLIMHTLEKAFDQRPIQAMPLACRRNESP
GNTNYVEWTCPATILDSGVRGHRDKLSDPKYSKVPPTRASGGDPITLNDKFEVWPNTQCV
KLNLAEDKDKHVKVVSASLKHLLTNAVYNVTADKFVICAGAVLTPGILWNSGFTTTFDSL
KPKYYVKQLGKNLTEQTMAFCQVKLWKEHVESVLTQAPEPDDSKKPDDSKKPDDSKKPDD
SKKPDDSKKPDDSKKRPPIKDTNTTNKPKAGLPEGWGSFWNTPVPMYWSQGEDDKKRDDS
WQALKTELKDKVAKHVETFKLDPLPFPADDPDPQCYYSFASSADKPWHTQIHRDAFGYGQ
VPANIDQRRVVDLRWFGYTPESAKNYVSFSTDIRDEFGMPQPTFHFSEDPNNKEADRKRQ
ADMRADMVKVANTLGYTITEDHEGKNNLPQGSALHICGTYKAGTPDGGSSENSVVNQYGQ
MWNHDNVVLGGCGVIPKANACNPTLTAACFAIHAVKKMVEELDK

Enzyme Prediction     

EC	1.1.3.10:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	417	642	2.2e-73	0.38979963570127507
AA3	61	339	1.2e-68	0.47358834244080145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274143	pyranose_ox	6.23e-129	18	642	1	546	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.
398739	GMC_oxred_C	2.20e-09	500	634	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	2.30e-08	17	292	7	275	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	6.88e-04	90	293	16	202	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
236223	PRK08294	0.008	12	57	27	67	phenol 2-monooxygenase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT76068.1|AA3_4	3.68e-133	17	643	20	542
QGI70943.1|AA3_4	4.12e-132	17	643	20	542
QGJ01833.1|AA3_4	4.12e-132	17	643	20	542
QGI88281.1|AA3_4	4.12e-132	17	643	20	542
QKD62719.1|AA3_4	1.16e-131	17	642	20	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BG7_A	4.23e-76	12	634	41	605	Chain A, Pyranose oxidase [Trametes ochracea],3BG7_B Chain B, Pyranose oxidase [Trametes ochracea],3BG7_C Chain C, Pyranose oxidase [Trametes ochracea],3BG7_D Chain D, Pyranose oxidase [Trametes ochracea],3BG7_E Chain E, Pyranose oxidase [Trametes ochracea],3BG7_F Chain F, Pyranose oxidase [Trametes ochracea],3BG7_G Chain G, Pyranose oxidase [Trametes ochracea],3BG7_H Chain H, Pyranose oxidase [Trametes ochracea]
2F5V_A	4.39e-76	12	634	13	577	Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus Peniophora sp. [Peniophora sp. SG]
2F6C_A	4.39e-76	12	634	13	577	Chain A, Pyranose 2-oxidase [Peniophora sp. SG]
1TT0_A	8.22e-76	12	634	41	605	Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_B Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_C Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_D Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],2IGK_A Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_B Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_C Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_D Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_E Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_F Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_G Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_H Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea]
3BG6_A	8.22e-76	12	634	41	605	Chain A, Pyranose oxidase [Trametes ochracea],3BG6_B Chain B, Pyranose oxidase [Trametes ochracea],3BG6_C Chain C, Pyranose oxidase [Trametes ochracea],3BG6_D Chain D, Pyranose oxidase [Trametes ochracea],3BG6_E Chain E, Pyranose oxidase [Trametes ochracea],3BG6_F Chain F, Pyranose oxidase [Trametes ochracea],3BG6_G Chain G, Pyranose oxidase [Trametes ochracea],3BG6_H Chain H, Pyranose oxidase [Trametes ochracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2E9|P2OX_EMENI	1.17e-79	19	644	24	580	Pyranose 2-oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=p2ox PE=3 SV=2
sp|Q6UG02|P2OX_PHLGI	2.90e-76	12	643	41	612	Pyranose 2-oxidase OS=Phlebiopsis gigantea OX=82310 GN=p2ox PE=1 SV=1
sp|P79076|P2OX_TRAVE	2.96e-76	12	634	41	605	Pyranose 2-oxidase OS=Trametes versicolor OX=5325 GN=P2OX PE=1 SV=1
sp|Q5G234|P2OX_TRAPU	4.04e-76	9	634	38	605	Pyranose 2-oxidase OS=Trametes pubescens OX=154538 GN=p2ox PE=1 SV=1
sp|Q8J136|P2OX_PENSG	4.23e-75	12	634	41	605	Pyranose 2-oxidase OS=Peniophora sp. (strain SG) OX=204723 GN=p2ox PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KID61418.1.