CAZyme Information: KID60423.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID60423.1
• CAZy Family: GT61
• CAZyme Description: raffinose synthase Sip1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		67620.30	5.6497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000019:411428-413528(-)

Full Sequence      

MAILAVSGVGSVTTTIRDNGHGVVAVHARNDSASSETTVVLISEGIDFDHAVASVMYHAR
TMVSETYGVSQNHNNSREKWDSKAITGWKPEWQDECVLPLLNAIEELARNKIQITNLIID
DNWQSLDRIGSDHSQYGWSEFEADRNAFPSGLRSVVAQIRNLHPALQNIIVWHAILGYWG
GISPNGLIAKTYSTIKVAQEGENSHPLTVVGKPDVSRLYNDFYRFLAESGIDGVKADAQV
MIDMLKDAPDRRDLISTYLDVSSKTSEEYFGGKTISCMSQFPYSLFHSQLPRSRGEFSVR
NSDDFFPDVPRSHPWHIWANAHNAIVTQFLNAVPDWDMFQTVHSYAEFHAAARCVIGSPI
YITDIPGMHNMHLIKQMTATTPLGQTVVLRPSVLGKSMCAYAGYEDGLLLKIGSYNGASQ
TGTGILGIFNVSTRHLTEIIPLGLFPGVFEGGKYAVRSHTTGQTSAPMTTGAPDSVIAAS
INEAGYEILCAFPLAQFKSGRYGNGYAGAVGLVGKMTGCAAMTYSSVVQRDSGTVIVTCN
LKALGTLGVYISTLRHLNIEDDFMVALEDQPVRFETVSRSEDDERIFEIDVERAWEEVAV
STMQRGEVQVKVSFQP

Enzyme Prediction     

No EC number prediction in KID60423.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
166325	PLN02684	9.50e-44	117	430	238	570	Probable galactinol--sucrose galactosyltransferase
283371	Raffinose_syn	8.14e-42	117	430	235	585	Raffinose synthase or seed imbibition protein Sip1. This family consists of several raffinose synthase proteins, also known as seed imbibition (Sip1) proteins. Raffinose (O-alpha- D-galactopyranosyl- (1-->6)- O-alpha- D-glucopyranosyl-(1<-->2)- O-beta- D-fructofuranoside) is a widespread oligosaccharide in plant seeds and other tissues. Raffinose synthase (EC:2.4.1.82) is the key enzyme that channels sucrose into the raffinose oligosaccharide pathway. Raffinose family oligosaccharides (RFOs) are ubiquitous in plant seeds and are thought to play critical roles in the acquisition of tolerance to desiccation and seed longevity. Raffinose synthases are alkaline alpha-galactosidases and are solely responsible for RFO breakdown in germinating maize seeds, whereas acidic galactosidases appear to have other functions. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36C.
165863	PLN02219	1.65e-41	117	430	235	571	probable galactinol--sucrose galactosyltransferase 2
215203	PLN02355	2.31e-40	104	553	226	715	probable galactinol--sucrose galactosyltransferase 1
215381	PLN02711	1.30e-30	117	430	249	599	Probable galactinol--sucrose galactosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI70052.1|GH36	0.0	1	616	1	615
QUC17938.1|GH36	8.07e-260	1	614	226	851
QPG96054.1|GH36	7.64e-257	1	614	227	858
UNI23494.1|GH36	1.92e-230	1	614	255	887
UKZ75409.1|GH36	1.91e-220	1	614	258	890

PDB Hits     

KID60423.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RX87|RFS6_ARATH	3.89e-38	54	430	164	568	Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=RFS6 PE=2 SV=2
sp|Q84VX0|RFS1_ARATH	1.39e-36	39	562	158	720	Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=RFS1 PE=2 SV=1
sp|Q94A08|RFS2_ARATH	3.62e-36	88	430	205	570	Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=RFS2 PE=2 SV=2
sp|Q8VWN6|RFS_PEA	2.27e-26	117	430	269	620	Galactinol--sucrose galactosyltransferase OS=Pisum sativum OX=3888 GN=RFS PE=1 SV=1
sp|Q9FND9|RFS5_ARATH	5.02e-25	117	430	258	607	Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=RFS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999719	0.000305

TMHMM  Annotations     

There is no transmembrane helices in KID60423.1.