CAZyme Information: KID60231.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID60231.1
• CAZy Family: AA2
• CAZyme Description: LysM domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		71368.94	7.0597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000020:188026-190209(-)

Full Sequence      

MQLSLALLNGLFIVPAVLATPHTRTKRGEKPAGKVDPGTASDCTYWEEKTDASTLQAAWS
ISAKDFGERNPLVKDDCSGMKIGNSYCVEVNYGLPRSTTTQQPTAVPTATSIGNGVTTPT
PTQPNMVDNCNKFYFVKEGDNCADIASANGISVEDFSRWNPKVGAQCTGLWAKTYACVGI
LGSTGSPTTAPTTTTIAGNGVVTPMPTQPGMVDNCNKFYFVKEGDGCAGIASANGISIED
FAKWNTKVGPQCTGLWAKTVKTPSPIQSDMINSCNKFHFVESGQSCQDIASRYGVTVSEL
TNWNPKAGSDCSRIFGQTWACVDPIRSFRFDDGSKNQWIVAEGSADTSSKALAMTSFSNK
AYYDVNFNDVAFEAQVTLRSGRSGNAGIMFRASDIGKGGDQYRGYYAGVSLVGDLVLGRV
NNDWRELSRAKISVSADRPLTIKALATGDQIAIYVDNIDRPALNVRDGTFRSGKVGVRTH
ETEAVFDNMFVSTVVFDDFERNLVNWQIYDGGFDARTHEMVASDVTSGKIAYQATFEDFI
LDIAITHGGDNRNAGFLFRAAGLGNGPDAYHGYYVGIDASSKVVLGRADGDWKHLGQNNV
GIRANQKYRLRVRAVGHSIDVWVDGKPYIQFRDSTYKRGMAGVRVYTTGAVVDNFTVAKI

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM66	502	654	6.3e-26	0.9806451612903225
CBM66	338	489	1.2e-24	0.9612903225806452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	3.09e-09	132	173	1	42	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.20e-08	276	318	1	42	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.96e-08	217	258	1	42	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	3.10e-07	277	318	1	41	Lysin motif.
180536	PRK06347	3.29e-05	85	304	285	508	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ88268.1|CBM50|CBM66	0.0	1	660	1	685
UKZ48216.1|CBM50|CBM66	0.0	1	660	1	687
UKZ74755.1|CBM50|CBM66	3.95e-255	263	660	4	403
UKZ69150.1|CBM50|CBM66	4.47e-254	270	660	1	393
UKZ74754.1|CBM50	1.01e-153	1	259	1	262

PDB Hits     

KID60231.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	7.16e-78	37	325	149	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AZ68|LYSM3_ARTBC	1.47e-12	107	255	242	398	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	6.97e-12	96	180	349	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4AVW3|LYSM5_ARTBC	1.65e-11	113	322	241	534	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B4P8|LYSM2_ARTBC	6.58e-09	54	191	43	192	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999725	CS pos: 19-20. Pr: 0.9731

TMHMM  Annotations     

There is no transmembrane helices in KID60231.1.