CAZyme Information: KID60033.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID60033.1
• CAZy Family: AA2
• CAZyme Description: alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		53226.99	5.1868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000022:287382-288920(+)

Full Sequence      

MILSGLFLLSQSLVMTTASQQLKVLQVGKTPNGFNGPAYGWSSFGMSVHSPTFEMNESSI
IQQCDVLSSTLGNNYPYCNLDAGWTGPTDNFGRIMYNKALNLPDLANHLHSRGLFLGVYV
VPGALKSDAKKTIYGTDVTIGQVCSGSEGLARCVFNYSRPEVQQWHNSIVAQFASWGVDL
IKLDYVTPGSPPPPGKQSKLPANQSEAVIAYHKAIENSGRQMRLDISWQLDLSEPSFAIW
NQNADSMRVDSDIINYQGSALTTWKAIQRAIDNYRNWTIAALDLPFALNIYADLSSLAVG
NNETLAGVNATQQQTIMTHAIASGSNLILDSDLTQLDGSLSQSLLLNASVLQLAAFTARY
PMQPRNPGTGGQDAKQLQAWIAGPSEDSRAVVVIANYGPDQGQGGFNTSLRGPQQVTVSW
TDLGISGCWQVRNAWTDEIEGRMDTSISVLLGEGESVLLDLTYVGLSSRVGTCGFAARAG
KFMSRFLFQTPG

Enzyme Prediction     

EC	3.2.1.22:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	168	438	7.9e-36	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	2.29e-53	37	351	1	266	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
178770	PLN03231	1.88e-11	37	353	1	345	putative alpha-galactosidase; Provisional
166449	PLN02808	9.73e-10	37	451	32	373	alpha-galactosidase
374582	Melibiase_2	2.16e-09	57	351	28	279	Alpha galactosidase A.
407673	Melibiase_C	4.97e-06	376	449	3	64	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI74156.1|GH27	0.0	15	492	1	478
QYT06308.1|GH27	6.16e-171	18	462	24	471
UKZ83979.1|GH27	1.75e-170	17	462	23	471
UKZ58293.1|GH27	2.49e-170	17	462	23	471
UKZ94504.1|GH27	9.98e-165	17	462	23	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F4C_B	3.00e-08	37	462	9	361	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
4OGZ_A	2.65e-06	31	223	101	243	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]
1R46_A	9.48e-06	75	333	55	269	Structure of human alpha-galactosidase [Homo sapiens],1R46_B Structure of human alpha-galactosidase [Homo sapiens],1R47_A Structure of human alpha-galactosidase [Homo sapiens],1R47_B Structure of human alpha-galactosidase [Homo sapiens],3GXN_A Crystal structure of apo alpha-galactosidase A at pH 4.5 [Homo sapiens],3GXN_B Crystal structure of apo alpha-galactosidase A at pH 4.5 [Homo sapiens],3GXP_A Crystal structure of acid-alpha-galactosidase A complexed with galactose at pH 4.5 [Homo sapiens],3GXP_B Crystal structure of acid-alpha-galactosidase A complexed with galactose at pH 4.5 [Homo sapiens],3GXT_A Crystal structure of alpha-galactosidase A at pH 4.5 complexed with 1-deoxygalactonijirimycin [Homo sapiens],3GXT_B Crystal structure of alpha-galactosidase A at pH 4.5 complexed with 1-deoxygalactonijirimycin [Homo sapiens],3HG2_A Human alpha-galactosidase catalytic mechanism 1. Empty active site [Homo sapiens],3HG2_B Human alpha-galactosidase catalytic mechanism 1. Empty active site [Homo sapiens],3HG4_A Human alpha-galactosidase catalytic mechanism 3. Covalent intermediate [Homo sapiens],3HG4_B Human alpha-galactosidase catalytic mechanism 3. Covalent intermediate [Homo sapiens],3HG5_A Human alpha-galactosidase catalytic mechanism 4. Product bound [Homo sapiens],3HG5_B Human alpha-galactosidase catalytic mechanism 4. Product bound [Homo sapiens],3S5Y_A Pharmacological Chaperoning in Human alpha-Galactosidase [Homo sapiens],3S5Y_B Pharmacological Chaperoning in Human alpha-Galactosidase [Homo sapiens],3S5Z_A Pharmacological Chaperoning in Human alpha-Galactosidase [Homo sapiens],3S5Z_B Pharmacological Chaperoning in Human alpha-Galactosidase [Homo sapiens],4NXS_A Crystal structure of human alpha-galactosidase A in complex with 1-deoxygalactonojirimycin-pFPhT [Homo sapiens],4NXS_B Crystal structure of human alpha-galactosidase A in complex with 1-deoxygalactonojirimycin-pFPhT [Homo sapiens],6IBK_A Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclosulfamidate ME763 [Homo sapiens],6IBK_B Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclosulfamidate ME763 [Homo sapiens],6IBM_A Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclosulfate ME776 [Homo sapiens],6IBM_B Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclosulfate ME776 [Homo sapiens],6IBR_A Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclophellitol epoxide LWA481 [Homo sapiens],6IBR_B Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclophellitol epoxide LWA481 [Homo sapiens],6IBT_A Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclophellitol aziridine ME737 [Homo sapiens],6IBT_B Crystal structure of human alpha-galactosidase A in complex with alpha-galactose configured cyclophellitol aziridine ME737 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92451|AGAL3_HYPJE	4.38e-118	22	461	168	620	Alpha-galactosidase 3 OS=Hypocrea jecorina OX=51453 GN=agl3 PE=1 SV=1
sp|C8VJZ7|AGAL8_EMENI	1.05e-75	25	426	69	479	Putative alpha-galactosidase 8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agl8 PE=5 SV=2
sp|P14749|AGAL_CYATE	4.19e-07	27	448	52	394	Alpha-galactosidase OS=Cyamopsis tetragonoloba OX=3832 PE=1 SV=1
sp|Q42656|AGAL_COFAR	5.07e-07	37	462	24	376	Alpha-galactosidase OS=Coffea arabica OX=13443 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002314	0.997671	CS pos: 18-19. Pr: 0.9272

TMHMM  Annotations     

There is no transmembrane helices in KID60033.1.