CAZyme Information: KID59585.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID59585.1
• CAZy Family: AA1
• CAZyme Description: Glycoside hydrolase, superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	AZNF01000026|CGC1	30800.03	6.3278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000026:18275-19099(-)

Full Sequence      

MNFTLYLVCIANLVQARRCVCPGEPNVQKPLTSTPPTVGKRGLAYNDARLVNTLRRPCRQ
CTWAYNWDWKDNGLSREVEFVPMLWNESTASQLQENMNVLRARGLKYILGFNEPDHADQA
DMTVARAVDSHIKYLNQDSDVAIGSPAVTSNEAGSTRDNPKSLDWLRGFLELCGQRGCKV
DFCVVHWYGSTTQADAMISFLHRAHDACPGKPLWLTEFSATGSSDEVEIFMMKVLPILDS
LQFIQRYAWFMTAVGNLLQSPDTLSSYGEKYASL

Enzyme Prediction     

No EC number prediction in KID59585.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	59	271	6.3e-59	0.9642857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.02e-60	44	271	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI66948.1|GH128	1.05e-60	36	273	137	372
UQC74149.1|GH128	1.13e-60	31	273	142	387
QUC23818.1|GH128	5.29e-59	35	274	127	365
UPK97883.1|GH128	1.25e-58	40	273	154	384
UNI20131.1|GH128	6.38e-58	40	274	88	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAY_A	1.33e-39	36	274	31	261	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB0_A	1.64e-39	39	274	3	230	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAQ_A	4.53e-23	63	271	47	259	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	1.22e-22	63	271	47	259	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	3.27e-22	63	271	47	259	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

KID59585.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999689	CS pos: 16-17. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in KID59585.1.