CAZyme Information: KID59256.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID59256.1
• CAZy Family: AA1
• CAZyme Description: alpha-1,6-mannosyltransferase Och1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		36254.07	6.9806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000032:13535-14506(+)

Full Sequence      

MKPSRSRSLLVISSLFVALSLLYFTLTQNAVVLTHISRISTKTNQAAQRGPLIPRNIWQI
YLRPPNANNGFQIDPSKISDAASWLARNPDYSYHLVGDQEASRLLYQHKLSNKKLREFYH
GLPNTGMKSDLLRYLILANEGGVYADTDVEAIRPIDTWIPEQYSENAKVVVGIEFDRLDG
PNWGQVHEELQFCQWTIAAAPNNPLLLRMVTSVVTRLEKHAKDRNSTVGEVGFSDSDVIN
LTGPSAWTDVVFEQLRIYQPRLTSVRDLTGLREPTLIGDILILPIDGFGMGQMHSNSTND
GSIPSDALVQHKFHGSWRTSNES

Enzyme Prediction     

No EC number prediction in KID59256.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	82	161	6.1e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.29e-25	51	320	80	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.26e-15	83	165	10	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ94407.1|GT32	4.10e-98	36	318	66	352
UKZ69802.1|GT32	1.52e-95	52	318	81	351
QYT06191.1|GT32	2.85e-95	52	318	80	350
UKZ83874.1|GT32	1.49e-92	52	318	80	350
AEO55065.1|GT32	1.16e-87	45	318	137	413

PDB Hits     

KID59256.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.16e-45	53	318	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.19e-34	54	318	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.01e-24	54	284	131	357	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.53e-21	53	318	96	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.795929	0.204078

TMHMM  Annotations     

Start	End
9	31