CAZyme Information: KID59255.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID59255.1
• CAZy Family: AA1
• CAZyme Description: kelch domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		73170.65	6.5000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000032:9946-12321(-)

Full Sequence      

MAILLSKISTLAALLLALAKVGNGQGTGQWGPLIKFPIVPVAVALVPESGNMIAWSSSWR
DRWTFTGDGKTYTALYDVKTGQVTEALIEASNTKHDMFCPGTSLDADGRLIVTGGSTAAK
TSVLDLKKNTSSWAPLSDMQIARGYQSSCTTSEGKVFVIGGSFSGSGVRNGELYDTKTDV
WTKLPGCPVRPLVIPRGMFPDSHAWLWSWKNGSVLQAGPSKRMNWYDTIGGGNVSSAGLR
DQDDDSMCGVSVMYDAVAGKIFTYGGGQAYTGFTSTSNAHILTLGRPGDQVQVQRLGNGA
YNRGFANGVVLPDGKIWIVGGMRMMEIFSDNTPQLTPELFDPATGQFQPTAPHTIPRNYH
STALLMADGTVWSGGGGLCGTGCAANKFDGQFWSPPYLFESDGQTLAKRPVIQRLSQTSL
RAGSSLVVEMQDTAKYTFSLIRMSATTHTINTDQRRIPFNVSPAPAKSFTLNIPADYGVV
IPGYYMLFALNEAGVPSVAKFLRVAFDVVDPPVNTDSPPVNTGNPAVNTGNPAVNTGNPA
VNTDPAVKTDVPTVKTDDPAVSTDNPPVNTGNPAVKTDVPTVKTDDPAVSTDNPPVNTGN
PAVKTDVPTVKTDVSTVNTAVPTVKTDPIVNTDPAVKTDVPTVKTDPTVNTDPAVKTDPA
VKTDPAVKTDPAVKTAVPTDTQTRPLGCPAAKL

Enzyme Prediction     

EC	1.1.3.9:34	1.1.3.13:3	1.1.3.-:1	1.1.3.7:1	1.1.3.47:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	24	504	3e-205	0.8061224489795918

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	7.75e-25	405	504	2	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	1.16e-20	415	504	1	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
276965	Kelch	1.88e-12	107	199	10	98	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	4.40e-12	107	189	57	140	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	2.00e-07	145	352	2	137	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EFQ30446.1|AA5_2|1.1.3.13	1.41e-275	6	504	6	504
OBR05259.1|AA5_2|1.1.3.13	2.19e-272	1	505	1	505
UBS89876.1|AA5_2	1.78e-271	1	504	1	504
UBS89875.1|AA5_2	2.53e-271	1	505	1	505
EHA47002.1|AA5_2|1.1.3.13	3.12e-217	28	504	126	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C86_A	3.88e-274	25	504	1	480	Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, apo form [Colletotrichum graminicola M1.001],5C92_A Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, in complex with copper [Colletotrichum graminicola M1.001]
2WQ8_A	1.24e-146	26	504	179	659	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
2EIC_A	2.22e-144	26	504	157	637	Chain A, Galactose oxidase [Fusarium graminearum]
6XLT_A	4.11e-144	26	504	158	638	Chain A, Galactose oxidase [Fusarium graminearum]
1GOF_A	1.24e-143	26	504	157	637	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2N3|GAOA_GIBZE	2.18e-142	26	504	198	678	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
sp|P0CS93|GAOA_GIBZA	2.18e-142	26	504	198	678	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	3.23e-12	96	504	94	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	2.24e-09	302	504	395	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.88e-08	92	507	478	906	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999765	CS pos: 24-25. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in KID59255.1.