CAZyme Information: KGB78771.2

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB78771.2
• CAZy Family: GH79
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705		78812.99	6.6326

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025760:356228-359483(+)

Full Sequence      

MVEPTDIPKKSLDKLGLPVRSIQDHALIGNLKTAALVSMDGSIESMCIPYFDSPSVFARI
VDADKGGHFSIVPTWSFKPKQAYAPNSNVLVTKFLSERGVGVVTDLLVPKGANLSNSSSR
AFLPWLIRKVESIRGTVPFKMECAPAFNYCRDKHTAEIVPDDSSANVTSQDTKVVFKSPS
LTLDLRMITWSSDQCVSDPEIKLRLADLSERGLLGPAATCDFELEEGQCVVFVMREVGDY
SYANEKHQEFANPTLSKAKSMGVPVEQMLEATNRLRPKENPILTRSLIEALIRDTTSYWK
KWIGGIKYSGRWRQAMLRSALTLKMLVFEETGAIVAAPTFSLPEFIGGQRNWDYRFTWVR
DSSFTLYALIRLGFTEEADAFVNFILERLKDRNSDGSLQIVYTIHGGKDLEEIELSHLAG
HKGSKPVRIGNGAADHLQLDIYGELLDCIYLAQKYSKPLGWDSWVAVRQVVDYVCSQVDK
PDLSIWEVRGKQKNFTYSKIMMWVAIDRGIRLADKRCLPCPNRSKWLETRDRLYETIQHR
AWNPSKRFFAQSYEDLNTLDSSVLIMPLVFFISAADPRFTNTLDAILKTPEKGGLTANNS
VYRYNAQLSDDGVGGEEGAFSLCTLWCVEALTRAGVFNAKYLDHAMNMFMDFLGYGNHVE
LYSEEISAGGEGLGNTPQAFSHVTLISAGFNLDRALSGSGRSAWA

Enzyme Prediction     

No EC number prediction in KGB78771.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	314	688	3.3e-76	0.9861495844875346

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225922	SGA1	8.54e-118	13	697	7	609	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395586	Glyco_hydro_15	4.53e-79	310	690	1	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	1.95e-15	289	635	223	547	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB78771.2|GH15	0.0	1	705	1	705
UOH84539.1|GH15	0.0	1	705	1	705
AFR94341.2|GH15	0.0	1	705	10	714
AUB23983.1|GH15	0.0	1	705	10	714
AAW46564.2|GH15	0.0	1	705	1	705

PDB Hits     

KGB78771.2 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10211|YAY3_SCHPO	7.88e-202	20	697	17	644	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
sp|P71741|TREH_MYCTU	1.46e-97	18	695	50	663	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
sp|A0R0W9|TREH_MYCS2	8.62e-96	7	695	27	651	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
sp|Q978S7|TREH_THEVO	4.59e-93	22	696	30	614	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1
sp|Q9HLE2|TREH_THEAC	4.17e-87	36	695	2	571	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KGB78771.2.