CAZyme Information: KGB78671.1

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB78671.1
• CAZy Family: GH79
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	CP025760|CGC10	35699.58	4.7704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025760:650232-651299(-)

Full Sequence      

MVLPNIKFTRPLTSANVVTLVALASFFFSVLYYALSPSPLLPFDTLSAPSPEPNKPNGTP
REAYVTFLSNEDPYYFASARLLVFALQHDPLTADPSRPVIVLTTPSVPASYSRKLEAEGA
IVIEKPPITSLPMVQTNPRWKDVYTKLWIFNLTSYDRLVYYDADHLVLRPVDSIWEAENS
WPEGGLAALGSGDGGYVEDSDYFLAGFFIAIPKGEIMEGLLAEKDYDPVFPEQNLMNKYF
SRDGPRPWAPLDPIHERISPKYEHVEQGAHTIHEKCWQGWVERRLAELFHERLGRMEGYW
LAKELNGTIPTSDPYG

Enzyme Prediction     

No EC number prediction in KGB78671.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	64	253	9.7e-20	0.7704280155642024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	9.11e-64	62	305	1	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	2.50e-09	63	181	72	194	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	1.59e-08	50	247	11	229	galactinol synthase
133064	GT8_GNT1	7.50e-08	63	172	2	109	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	6.08e-05	135	240	75	197	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB78671.1|GT8	8.49e-238	1	316	1	316
AAW46473.2|GT8	4.91e-212	1	316	1	316
AUB24114.1|GT8	6.67e-210	4	316	4	316
AFR94453.2|GT8	6.67e-210	4	316	4	316
ADV21652.1|GT8	1.97e-207	1	316	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	6.76e-06	58	227	4	176	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3V90_A	7.59e-06	62	252	24	198	Structure of T82M glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus],3V91_A Structure of T82M glycogenin mutant truncated at residue 270 complexed with UDP-glucose [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09680|YA0C_SCHPO	1.86e-10	66	277	76	340	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|Q4PSY4|GOLS7_ARATH	1.31e-08	54	258	11	235	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|O43062|YGT9_SCHPO	6.60e-07	65	176	81	198	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|O22693|GOLS4_ARATH	7.85e-07	60	242	21	226	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q947G8|GOLS1_SOLLC	1.77e-06	63	240	21	210	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000001

TMHMM  Annotations     

Start	End
12	34