CAZyme Information: KGB78164.2

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB78164.2
• CAZy Family: GH5
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	CP025769|CGC2	95382.21	6.1060

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025769:711955-714804(-)

Full Sequence      

MSNQAMDRSFLTASVEELVSMMSLGEKVSLLAGEDWWRTVAIPRLNIPSVKVTDGPNGAR
GESFFDMTPATVLPNATALAATFSPTLPGEAARLLAKETKARSAVCLLAPTVNICRSPLG
GRAFESFSEDPTLSGILAAKYINGLQSEGISATLKHFIANDQEHERMGQDAIIGERALRE
VYLRPFHIAQARADPWSYMTSYNKLNGTHCAEHPWLLKDLLRKEWGFDGLVMSDWMGTYS
VSEAINAGLDLEMPGKARWRQFQLVRQMVNAHKILPATIDERVINLLRWVQKMATLNPDI
VYERDDRKEWTRNEDREADAALVRKIGNEAIVLLKNENAVLPIKRGKVAVIGPNAKNSVI
TGGGSARLRPSWRVTPWEGLVNNKPDDIELSYALGCKGSKFLPIFGPEFTSMDGEIPGSF
DLLHYAIDASGKQASKPAVSQVWHNSDIMLADFRHPDLGEDYFTEVHALFTAPITGHWDF
EVSVTGQAWVYMNDQLVADLSKEQKRTSSFFGNGGNGTVFTVAVDKGKVYKFRLVHDSRK
PPLAPGQDSQPLQLIGMKLGSFPSISEDTTIDEAVALAKESDTVVLVVGLDHDWESESYD
RPNLSLPLRLNELVHRVATEAPNANKVVVLQTGSAVSMPWRENVDSVVWPWYGGNEAGNA
IADIIYGTVNPSGRLPLTLPERELDIAANLNFRSARTKTYYEEGIWVGYRHFNARGIKPM
YPFGHGLSYTEFDYADLQVVSSSSNTPNDWRIRVCAKVTNIGQVAGAHSVHFYVTPPPPT
SNSLLHPEVTLQGFTKTGILPPGGSEKVSIEMDKFAISHWDELTSTWRAESGQWLVRIGR
DAQTMCLQAPFEVPSGFKWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	254	6.3e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.03e-71	44	852	101	763	beta-glucosidase BglX.
224389	BglX	1.33e-67	37	367	50	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.93e-51	11	813	49	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	7.21e-46	331	729	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.37e-41	44	288	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB78164.2|GH3	0.0	1	862	1	862
ADV25063.1|GH3	0.0	1	862	1	848
AUB23806.1|GH3	0.0	1	862	1	862
AFR94189.2|GH3	0.0	1	862	1	862
QKD55271.1|GH3	0.0	1	862	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.52e-184	15	862	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.47e-180	15	862	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.32e-120	11	858	1	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.08e-95	15	853	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.12e-94	19	849	9	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	2.21e-206	15	862	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.21e-206	15	862	6	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.21e-206	15	862	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	8.78e-206	15	862	6	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	7.20e-205	15	862	6	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KGB78164.2.