CAZyme Information: KGB77882.2

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB77882.2
• CAZy Family: GH5
• CAZyme Description: beta-1,4-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		54013.57	5.2406

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025759:2204102-2205681(+)

Full Sequence      

MSLPKDFIWGFGTASYQIEGAIKQDGRGPSIWDTHCDKPGAIADGSSGEIACDSYNRTAE
DIALLKSYGAKAYRFSISWSRVIPLGGRNDPINDQGLNHYVQFVDDLLAAGIQPLVTLYQ
WDLPEALHQRYRGPLNKDEFVADFTNYARIMFRALSPKVKIFMTFTEPWVISIFGYQNGL
FAPGRSSDRTVCAEGDSTREQWIVGHNLLLAHASAAKVYREEFKPTSEGEIGLTNLGDWA
YPYDKNNEKDREAANRFVEFCLGWFTDPIYLGDYPKSMREQLGDRLPKFTSEEAALVKDS
NDFFGLDYYTANYIKHADTPAADTDFMGNLEKSWVNSDGQVIGPESQHVRMRPNPQGLRA
LLNWIHKRYNGPKIYLVENGTSVKGENDLPMIEAINDEFRCDFYRGHIDAVVQARMQDGV
NVGSYVAWSLLDNFEWTDGYATRFGVTYVDYKDGQKRYPKKSAKLLSKIFDSYIEK

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	471	2.2e-150	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	5.27e-163	2	469	4	447	Glycosyl hydrolase family 1.
225343	BglB	3.31e-131	1	472	2	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.51e-115	2	475	27	485	beta-glucosidase
215455	PLN02849	5.71e-105	4	467	31	477	beta-glucosidase
215539	PLN02998	4.03e-98	3	470	31	485	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB77882.2|GH1	0.0	1	476	1	476
AEO57459.1|GH1	1.13e-235	1	476	1	475
AEO69521.1|GH1|3.2.1.21	1.24e-232	1	476	1	475
CAE7220638.1|GH1	3.35e-231	3	476	6	479
UQC78120.1|GH1	4.11e-231	1	476	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.53e-230	1	476	24	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.63e-223	3	476	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.49e-221	1	476	1	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	2.00e-220	3	476	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.34e-215	3	474	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	6.95e-185	3	474	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.96e-172	3	475	6	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	9.89e-148	4	466	34	498	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	5.27e-141	2	469	38	507	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|Q9SPP9|RG1_RAUSE	1.37e-140	4	476	23	517	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000003

TMHMM  Annotations     

There is no transmembrane helices in KGB77882.2.