CAZyme Information: KGB77682.1

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB77682.1
• CAZy Family: GH47
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	CP025759|CGC10	47091.53	9.3160

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025759:1658372-1659812(+)

Full Sequence      

MVKLSPLALIFIAACFSRILHLTVLSGLSKALPLFDTSPSLLLPSPPPSLRWDAIHFSSI
AYNGYKYEQQVAFQPGWLAVMRLAGEGVRFIRAAPVVELRDVILGGTIMANFAFVAATLV
LYKLTKHIFNPTFALLTSLLYLLPPTATTSAPYTEPIYSLLTFSGVYLLSVKRQMALASL
CFAGATTVRSTGIFSLFTLMCFAVYGDAHIFDLDLINKDYFKRAWKPCLPALLVVAPFLM
FQYYCETVFCTRESKLANTARPWCSNSPPVSYGFVQKLYWNVGPFEYWTLAQLPNIALAM
PILSSSLLGVVKFFSHMVSSSQVHNHGTDEKPPPPILFGLYSVHLLTMALLLFTSHTQIA
LRVCLGDPVVWWNAVKLGFDNVEMHEARKGQVKINKFGRYWVGWTVVWGAIAAILWAGHY
PPA

Enzyme Prediction     

No EC number prediction in KGB77682.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	48	423	6.2e-96	0.8722358722358723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.20e-33	52	423	60	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.67e-10	52	423	74	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB77682.1|GT76	4.84e-314	1	423	1	423
ADV21212.1|GT76	1.07e-281	1	423	1	425
UOH80020.1|GT76	2.15e-266	1	423	1	420
AFR93820.1|GT76	4.35e-266	1	423	1	420
AUB23397.1|GT76	4.35e-266	1	423	1	420

PDB Hits     

KGB77682.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	2.47e-266	1	423	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	3.36e-264	1	423	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.09e-34	35	423	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	5.57e-29	51	372	65	415	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.09e-26	22	423	33	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.597888	0.402108

TMHMM  Annotations     

Start	End
7	29
102	121
128	147
152	171
192	211
231	250
296	318
333	355
397	419