CAZyme Information: KGB76680.1

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB76680.1
• CAZy Family: GH18
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		95463.97	5.6838

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025766:1127311-1130169(-)

Full Sequence      

MPTNNADLDRSFLTANIDDLLKQLTTEEKISLLAGKDWWNTVPIPRLNIPSIKMSDGPGG
ARGDSFYHMTPASALPSATSLASTFSPDLVHSAGSLLALETLARNAVCLLAPTINIQRSP
LGGRAFESYSEDPTLSGLIAAAYVTGLQEGGVSAAIKHFVGNDQEHERMGEDSIIAPRAL
REIYLRPFQIALKKSKPQAFMTAYNKLNGTHCSENGWLLEELLRKEWGFDGLVMSDWFGT
YSVSESINAGLNLEMPGATRWRPNGLVTHLIKAHKIDPRQLDKVAGGVLRWVQKLAKKNE
ELVYSLPGKERTRTEDQAEDAEFLRRLAGESIVLLKNEMDVLPIRGHKKIAVIGPNAKAK
VLTGGGSAQLRSAWSSTPWQGLSDNAPEGVEISYSLGCYSSKFLPILDDNFTCPDGSSGF
QLSHFPITSSGDKAEEPVHVETWDTSDMFLADFTAPGLTEKYFTQLDAVWTPVEDGEYEF
GVIVTGKGWLWVDGELVIDGSREEERSSSFFGSGTRELKGRTKVKKNRRYDIRLLHDTRP
YSVSNLITPIVSAGMRLGYRQIISTSTLLSKTVSLAASSDIALLVVGLNSDWESEGYDRP
NLSLPMDTDELVSAVAEANPNTIVVIQAGSAVSMPWLNKVKGVVFAWYLGNETGNAIADI
IYGYTNPSGRLPITFPRRELDIAANLNYKSARTKTYYDEGIWVGYKHFNARGIDPLFPFG
HGISYTTFVYSDLHISQLPESPKNVGADGWKMDVEVQVKNTGKEEGAHTIMFWLSPPPES
PSGLKHPEWTLQGFQKVYSLKPGEKRKVKVTFDKYAISHWDELWNTWRAELGEWAVRVGV
DAQNISGEKATFRVEDDLEWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	44	256	2.8e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.44e-68	15	852	36	762	beta-glucosidase BglX.
224389	BglX	3.46e-66	44	369	55	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.18e-49	332	725	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.82e-37	42	290	59	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.93e-33	20	813	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76680.1|GH3	0.0	1	863	1	863
ADV23736.1|GH3	0.0	1	863	1	863
UOH84802.1|GH3	0.0	1	863	1	863
AAW44922.2|GH3	0.0	1	863	1	863
AGV14847.1|GH3	0.0	1	863	1	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.91e-211	16	863	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.10e-206	16	863	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.16e-128	13	845	1	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.17e-107	13	846	1	656	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	4.25e-101	14	847	51	822	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	1.74e-240	16	863	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	6.98e-240	16	863	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WU49|BGLI_ASPFU	3.07e-238	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.07e-238	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.47e-237	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KGB76680.1.