CAZyme Information: KGB75788.2

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB75788.2
• CAZy Family: GH114
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	CP025763|CGC4	46134.45	5.0834

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025763:1154966-1156729(-)

Full Sequence      

MPSLNHLFIPSITAIFSLVLFLSTHALAVRQLTVSNKCSLSIYVAVGGKGGALTTIGGAA
QLAGWKQVPGDYSFNVPDGWNNGRIWARTGCTLNGDTLDCVVGGCSGNTIKCSGFEYGKP
GATLAEFTIDVNHMDSYDISIVDGYNLPMEITSSDPSCAKGSCGTETDILTQCDPSLVYP
KNSDKIYSCNSACGNLIQFQDGTGGDLISADANNSPVCCVHNGVAVHHINCPNTYIPFYQ
TMKKMCHNAYVYSDDDMYNDAVSTCPSTNKPSYTITFCPNGDAAGLNLPSSSLAVSQDST
PGDNSGNLSSGPATVSIWTAVTGTLIESGPGPTATNAAQSRINTGAASFSAVTAVTSATG
GQAMSSSAKSKAITSAATSFRDSSNWHTHSGLVAAIELTTTSALAMTSSDAPEQLEGSIT
THISNGNVCVKVVMIETKVVHGRDA

Enzyme Prediction     

EC	3.2.1.39:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH152	36	279	1e-51	0.9953703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395248	Thaumatin	6.62e-50	36	279	1	211	Thaumatin family.
185758	TLP-F	7.89e-41	32	279	1	229	thaumatin-like proteins: basidiomycete homologs. This subfamily is represented by Lentinula edodes TLG1, a thaumatin-like protein (TLP), as well as, other basidiomycete homologs. In general, TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. TLG1 TLP is involved in lentinan degradation and fruiting body senescence. TLG1 expressed in Escherichia coli and Aspergillus oryzae exhibited beta-1,3-glucanase activity and demonstrated lentinan degrading activity. TLG1 is proposed to be involved in lentinan and cell wall degradation during senescence following harvest and spore diffusion. TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. TLG1 from Lentinula edodes contains the required acidic amino acids conserved in the appropriate positions to possess an electronegative cleft. TLPs within this subfamily contain 13 conserved Cys residues; the number of total Cys residues in these TLPs varies from 16 in L. edodes TLG1 to 18 in other basidiomycete homologs.
185757	TLP-PA	1.01e-37	31	278	1	219	allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. TLPs within this subfamily contain 16 conserved Cys residues.
128501	THN	6.44e-33	32	279	1	218	Thaumatin family. The thaumatin family gathers proteins related to plant pathogenesis. The thaumatin family includes very basic members with extracellular and vacuolar localization. Thaumatin itsel is a potent sweet-tasting protein. Several members of this family display significant in vitro activity of inhibiting hyphal growth or spore germination of various fungi probably by a membrane permeabilizing mechanism.
185756	TLP-P	2.40e-27	32	191	1	141	thaumatin and allergenic/antifungal thaumatin-like proteins: plant homologs. This subfamily is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii, allergenic/antifungal Thaumatin-like proteins (TLPs), and related plant proteins. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs in this subfamily include such proteins as zeamatin, found in high concentrations in cereal seeds, and osmotin, a salt-induced protein in osmotically stressed plants. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. IgE-binding epitopes of mountain Cedar (Juniperus ashei) allergen Jun a 3, which interact with pooled IgE from patients suffering allergenic response to this allergen, were mainly located on the helical domain II; the best-conserved IgE-binding epitope predicted for TLPs corresponds to this region. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75788.2|GH152	0.0	1	445	1	445
AAW44358.2|GH152	1.44e-260	1	444	1	448
AUB26138.1|GH152	1.67e-238	1	429	1	434
AFR96243.2|GH152	1.67e-238	1	429	1	434
UOH81800.1|GH152	1.70e-217	1	429	1	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Z3Q_A	2.61e-22	36	279	7	200	Resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7A [Musa acuminata]
2I0W_A	1.09e-21	34	281	5	207	Chain A, Protein NP24 [Solanum lycopersicum]
5YYQ_A	2.80e-21	36	279	7	205	Structure K78A thaumatin [Thaumatococcus daniellii]
5X9M_A	2.80e-21	36	279	7	205	Structure of hyper-sweet thaumatin (D21N) [Thaumatococcus daniellii]
5YYP_A	2.80e-21	36	279	7	205	Structure K137A thaumatin [Thaumatococcus daniellii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1P8B554|THLP1_ARATH	8.87e-30	16	280	14	257	Thaumatin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=TLP1 PE=2 SV=1
sp|P28493|PR5_ARATH	7.16e-23	11	279	3	239	Pathogenesis-related protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g75040 PE=1 SV=1
sp|Q8H994|CRJ33_CRYJA	8.09e-23	25	278	18	229	Pathogenesis-related thaumatin-like protein 3.3 (Fragment) OS=Cryptomeria japonica OX=3369 PE=1 SV=1
sp|P50702|OS81_SOLCO	8.49e-23	15	289	9	235	Osmotin-like protein OSML81 OS=Solanum commersonii OX=4109 PE=2 SV=1
sp|Q8H995|CRJ32_CRYJA	1.19e-22	20	278	16	232	Pathogenesis-related thaumatin-like protein 3.2 OS=Cryptomeria japonica OX=3369 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.144841	0.855141	CS pos: 28-29. Pr: 0.6345

TMHMM  Annotations     

Start	End
7	29