CAZyme Information: KGB75735.1

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB75735.1
• CAZy Family: GH105
• CAZyme Description: phosphatidylinositol glycan class M

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		47547.11	9.9314

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025761:1390900-1392292(-)

Full Sequence      

MLRAKTFQIILVSLSLHLALILYADHVDSHPERYGGLRYTDVDWRVVTDGARLIFNPSDE
EQAKGWFVKKTGSPIGDPYNRATFRYTPLLPLFLSPALIHPLLGKCLLALPSLLIPLLLL
SGPYPAPFWPTHLLWTINPLVLSITTRGSPEAAICFLVIALHYFLRLGSEDKKKGAGETR
AAIMLALAVSWKIYPAIYIPAVWKELSTRWGWFGARVWRFGFIAASSFVLINGVLWSIWG
QPFLDHTYLYHLSRLDHRHNFSPYFYPIYLSFFPSPTASPLPSALLAVIRHPLTSFLPQL
TLILTTSLSISSLDFAMFLQTALFVAFNKVCTSQYFTWFLPLLPPVIPQLHLSRRKTVTL
VIGWILAQGVWLGSAYLLELKAQSVYIVVWAAGLLVFGVSIYVLGNLIDGWAPPARTTKG
KLD

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	144	408	4.8e-80	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
252941	Mannosyl_trans	7.13e-59	144	408	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
178434	PLN02841	3.24e-54	9	408	11	415	GPI mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75735.1|GT50	2.80e-313	1	423	1	423
ADV19492.1|GT50	4.00e-295	1	421	1	421
AUB22890.1|GT50	1.84e-279	1	423	1	422
AFR93356.1|GT50	1.84e-279	1	423	1	422
AAW41613.1|GT50	4.13e-276	1	423	1	422

PDB Hits     

KGB75735.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5F380|PIGM_CHICK	6.71e-65	18	419	20	413	GPI mannosyltransferase 1 OS=Gallus gallus OX=9031 GN=PIGM PE=2 SV=2
sp|Q7T310|PIGM_DANRE	1.20e-61	37	416	32	389	GPI mannosyltransferase 1 OS=Danio rerio OX=7955 GN=pigm PE=2 SV=1
sp|Q54IA4|PIGM_DICDI	1.73e-59	6	408	25	427	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.70e-57	5	418	9	416	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q8C2R7|PIGM_MOUSE	7.54e-55	37	423	45	423	GPI mannosyltransferase 1 OS=Mus musculus OX=10090 GN=Pigm PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000573	0.999401	CS pos: 24-25. Pr: 0.9686

TMHMM  Annotations     

Start	End
7	24
82	104
106	128
143	165
181	203
218	240
264	286
296	318
325	347
357	379
386	408