CAZyme Information: KGB75523.1

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB75523.1
• CAZy Family: CE4
• CAZyme Description: Ricin B-type lectin domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A095EDK6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		20029.40	4.1501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025761:819636-820358(-)

Full Sequence      

MVAIPTLLSLLLTSTFITSAPSSATTEVQDPPPGNGRRIRPYGRPDLCVMVGNGYAAYGT
AVNIAYCQSNEATWAPLQLWNVTNDSSGPIPLQSKIGDMCLSAGDNPVSGSSLTIDHCGN
GQKQTWNYSAQNKIQLDSTDLCLDVKEGSGPINQNPYVIVKELQVWECTDDNNNQIFFEL
PYPNT

Enzyme Prediction     

No EC number prediction in KGB75523.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	45	177	5.3e-20	0.6223404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.74e-14	38	177	4	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.20e-11	38	175	2	121	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	2.85e-08	43	179	4	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
238092	RICIN	2.66e-06	98	177	10	80	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	0.002	37	126	46	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75523.1|CBM13	3.84e-137	1	185	1	185
AFR92717.1|CBM13	7.40e-126	1	184	1	184
AUB22179.1|CBM13	7.40e-126	1	184	1	184
UOH79547.1|CBM13	1.37e-124	1	184	1	184
AAW41423.2|CBM13	7.96e-121	1	184	1	184

PDB Hits     

KGB75523.1 has no PDB hit.

Swiss-Prot Hits     

KGB75523.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000603	0.999382	CS pos: 24-25. Pr: 0.6963

TMHMM  Annotations     

There is no transmembrane helices in KGB75523.1.