CAZyme Information: KGB75350.2

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB75350.2
• CAZy Family: CE17
• CAZyme Description: alpha 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	CP025761|CGC3	63859.20	6.1168

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025761:321405-323397(+)

Full Sequence      

MDDPEKGLSPTSTPSSTAPTRLSSPVLQHVSFAHNLSPLRRHQHPSTIPHIGLRKRRLLS
QIIFALGILSIIGWAVVGENGMRDVITIIGSKGQGQQRPHDAPVPGIILGTKGKPMPLPD
IEPMEPPADVQESSQSSPTPQKGGEDDEEGLSFAEKMAKLSHISSRKWGLDLSSAKLLNG
LAPWPSNPPINESAEALSVLGHFADDVYNYGPDTIEEYRKHLRTFIDVGWPKKLKEVLTK
GLDRFTMSDAGPVEGEEGYWDWDREKYVWQTDKDLRHAESEEVASWKDWRMDQEGWKWDL
LTDDDANKWVKKNLAGTKIEEVWDNLPSGILRADTLRYLLLLLRGGIYSDTDTVLLKSPS
HWGQGARLWNDGEGWLTEDQKKRLEEGAQIEEVLGKPSVIVGLEADVGDREDWHDWWPRP
IQMVQWTMASAPSHPIALSAVLRILHSTATAISWAHENARVVNILKDQGRYKDAQNLASV
SVLNEPKHGGPVGVMAWTGPGVWTDAVLSYLRVKYGVKWVDFKGMQEPLRIGDVVILPVT
GFSPGVGNFGSQHRTHREAMVEHRFAGSWKND

Enzyme Prediction     

No EC number prediction in KGB75350.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	282	363	3.2e-17	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.38e-09	265	572	83	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.16e-04	287	369	9	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75350.2|GT32	0.0	1	572	1	572
ADV19938.1|GT32	0.0	3	572	2	571
AAW41222.1|GT32	0.0	1	572	1	572
AUB22355.1|GT32	0.0	1	572	1	572
AFR92874.2|GT32	0.0	1	572	1	572

PDB Hits     

KGB75350.2 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.10e-47	266	572	144	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	2.30e-37	268	572	100	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5A4E3|OCH1_CANAL	3.67e-36	326	572	165	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.01e-19	267	571	133	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999898	0.000091

TMHMM  Annotations     

Start	End
58	77