CAZyme Information: KGB75297.3

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB75297.3
• CAZy Family: CBM50|CBM50
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909	CP025761|CGC10	97131.30	3.9748

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025761:153841-156725(-)

Full Sequence      

MSAFTYTAALFSLISLLPSAFAGPTAGATYSISPNQHPSMCLAPAHDWEGADVVIKNCDE
DDTTWLWTGQSFQNTATQMCIDIRDAGAWSGNKAQVWGCFPYNTNQQFNVEGSMIHWEDF
CWDLTDGSSSAGTKLQIWSCFSYNDNQQWTFTEIEEVDECDATSVTETVTIMSTATASNS
DLSSATASASASSNPKAVSAAESLTASLTASLNASDPFFTASATGSGYEADATASATESA
YESLNGTASATYSSYNVNATASATYSSYNVNATASATYSSYDVNATASATYSSYDVNATA
SAADSGYESINATASATESGYEFVNATASGTLSASGTLSAETSTATNSSIGEGLWSPHKS
SSVSSDEWSSETATDSSTEWWPSSTGSNSNSWASATASASNPWQSASESGAWNSTSTASN
SWETASQSDSWNATSTASSSWETASQSDSWNATSTASNTWETASSSQAWNETSTDSWVAS
ATATATESDPYGSATSTSTSSAISATATVGTISSGYLQTSGTKIVDSDGNEVILRGTNIG
GWLVLEDWMCGISDESGSADRFSLTTLENRFGTAQARTLVEAWAENWLTSADFDELANIG
FNVIRLPFSFRTVQNADGSWRDDAFTRMDWAIAQAKARGIYVIVDFHMWAGQEADYSAIS
ENTDEGQSQRDAAGELWKKVATHYLGESSICAFDVINEPTGSYGDYLQQDLYNAVRSVDA
NRIIIHESISTDPSTYGWTNVIYSLHEYDMMGSDFDSNKATWASGVQAYIDLWHGYNIPF
MLAEFMADGDTLDYMLNSLNSQGLSWLTWAHSTVNMGRWGIWNHEAFSVDVSSDSYDTIY
NTWTNMPSTFQTYIYGQLKNAATGSTSVSRKRDLAPSARTTKRLHGSHGGRSRRNGVAHA
VKGAVAVSI

Enzyme Prediction     

No EC number prediction in KGB75297.3.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	566	810	1.5e-53	0.9885931558935361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	7.64e-22	589	810	26	267	Cellulase (glycosyl hydrolase family 5).
395527	Ricin_B_lectin	4.97e-16	35	149	7	126	Ricin-type beta-trefoil lectin domain.
225344	BglC	3.86e-13	586	749	72	243	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	2.61e-10	72	153	5	86	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.47e-09	38	151	9	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75297.3|CBM13|GH5	0.0	1	909	1	909
ADV19959.1|CBM13|GH5	0.0	1	909	1	876
AAW41305.1|CBM13|GH5	0.0	1	909	1	847
UOH79756.1|CBM13|GH5	0.0	1	909	1	789
AFR92930.1|CBM13|GH5	0.0	1	909	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	2.41e-12	526	747	8	242	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	3.11e-12	526	758	3	260	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	4.27e-12	526	758	9	266	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	5.49e-12	526	758	3	260	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	5.65e-12	526	758	8	265	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	4.04e-25	516	752	3	252	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A1CRV0|EXGA_ASPCL	5.99e-19	533	750	41	272	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	6.21e-17	533	750	41	273	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	6.21e-17	533	750	41	273	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	5.70e-16	534	771	29	275	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999767	CS pos: 22-23. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in KGB75297.3.