CAZyme Information: KGB74945.2

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB74945.2
• CAZy Family: PL4
• CAZyme Description: alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	CP025760|CGC1	49307.42	5.8532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025760:1317898-1319495(-)

Full Sequence      

MTLTTLPHPRLLPLILAVLFLIFALSSLLFRGYTPILNPIPNSFVRRERTQNPYSLSGYK
GNTISIQTVLDAGARFIAESSEHFDIVGAKRDLGIDIGGNWTLQSYADYLENTWHEFLVP
QGSNADHPTLQTVISYTSLLPREQEIETAIPKLIYTTDLLEPQQLPEQFQSWITQNPDWT
AMFVEDKQIDTWLEKSLGSKGIKSKAQEELLALKEKWGVVRADLFRYLVLLLNGGIYTDT
DTASVLPIAQWARNPTVAAIAPLLTAIPQLISIIQDPSQSLFSTTSTSEPSLVVAIESDA
LSTGANWREQSFTRGIQIVQWTIMANRGHPVLLDVIGMTLRKCEEIRQMELNNGEVRKED
VNILDWSGPGAFTDAVFRYLLVRYGFHPTQASGLKEPLKVGDVIIMPVHSFRADASEGFQ
GAHKVVWHGFFGRWKGKTDK

Enzyme Prediction     

No EC number prediction in KGB74945.2.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.80e-10	147	332	79	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.98e-10	168	251	7	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74945.2|GT32	0.0	1	440	1	440
ADV21986.1|GT32	3.76e-292	1	440	1	420
AFR94929.2|GT32	7.86e-257	1	439	1	445
AUB24663.1|GT32	7.86e-257	1	439	1	445
AAW42866.2|GT32	3.76e-246	1	440	1	439

PDB Hits     

KGB74945.2 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	6.71e-29	126	435	79	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.75e-25	150	435	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.46e-19	219	427	196	377	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.77e-17	176	440	129	475	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
12	34