CAZyme Information: KGB74299.2

Basic Information

• Species: Cryptococcus gattii VGII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGII
• CAZyme ID: KGB74299.2
• CAZy Family: AA1
• CAZyme Description: beta-1,2-xylosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		71892.79	6.6313

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiVGIIR265	6705	294750	281	6424

• Gene Location: location=CP025762:1100822-1103656(-)

Full Sequence      

MPRYLRIYVAVAAFALLAAVHYYLPPFHRSGPPSPGAEPYFASSPSSSVFDGEDGQRTDS
SGVVVDKKGLMSYSPGHARHPVEMLIEKGKKLAEEMEHRIASVKSVRDSAKDYLLAFGMR
PPRGFDAWYAYTQSVPAPHPPSLPSLIPLVHKPMLPFLSHPAALLRTRVEKLRDADGSIF
TLTFVPDGQGDRGTACAANGEWHVKDWHVRDKGMVLVRGAAAWSWRCNNTLSLLLPLLPL
MPEEMSNQNPPLELAFSVDDGPRGMVHNTFRERSEALARSGRLWPEAQLHQAEQAMRWTY
GWSWSCPENTPLKDRGSDLVLNDMTDIVSANAESQHVAGDKTFIADFDKSIDYCMNPDLM
SLHHILLSEQHRAAVNLVPALVTCRTKWNSDLVGVPLDGVHETVEFIPWEKKKIHKAFWR
GTATGLSHDKLSAWRQSQRERLHWFGNNMTGTVPLLLPDGSIKHWDRADLVDKWLDVGLS
GGPTQCNVEDGTCDAMAKEIDFKDRVSKEDGIKYKYVIDVDGNGWSSRFRRLLQGNNVVF
KSTLYPEWFHDMLIPWYHYVPTKLDYSDIFDILAFFQGSPDGSIPGRDDLAKEIAAHAHE
FVQERWREEDMRSFMYLLILEVSLVFAHPTKSTFWC

Enzyme Prediction     

No EC number prediction in KGB74299.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	374	623	2.3e-60	0.896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.67e-19	407	623	78	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	7.30e-12	502	623	205	320	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74299.2|GT90	0.0	1	636	1	636
ADV20524.1|GT90	0.0	1	632	1	593
AUB22757.1|GT90	0.0	1	633	1	633
AFR93241.2|GT90	0.0	1	633	1	633
UOH81501.1|GT90	0.0	1	623	1	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.93e-10	510	623	233	339	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.99e-72	75	621	147	651	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	7.57e-11	369	603	241	443	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|G3V9D0|PGLT1_RAT	2.15e-10	510	623	261	367	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.18e-09	510	623	261	367	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.57e-09	510	623	261	367	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000006

TMHMM  Annotations     

Start	End
7	24