CAZyme Information: KFL62339.1

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: KFL62339.1
• CAZy Family: GT59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538		61022.25	8.2226

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700654:1300047-1301885(+)

Full Sequence      

MAADDRAFASGTSPNTDLRRRNVPGAEKSSANVPIPSIEVDGKKLKEKSPSFCEILDDLE
VFIAPLIFTALACFTRLWRIGLSDIVTWDEAHFGKFGSYYIKREFYFDVHPPLGKMLIGL
SGFLAGYNGSFEFKSGEKYPPEVNYTFMRIFNAFFGIMCVPLAYYTARELKFRRPAVWLI
TLMVLCENSYATISRFILLDSMLLCFTFTTTLCWARFHRLRHESFSPEWYLWLILTGLSI
GCVCSVKWVGLFCTALVGLYTAEDLWHKFGDLKMPKTVLAHHLGARVFGLIIVPFLVYMF
SFYIHFLVLENSGTGDAQMSSLFQANLRGTNVGKDSPLEVAIGSKITLKNMGYGGGLLHS
HVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGPIAFIGDGDVIRLIHAQTG
RNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDVASRDRSKIRTLTTALRLR
HTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNIESHVNERRMYFFSLLL

Enzyme Prediction     

EC	2.4.1.109:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	68	306	5.6e-77	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	59	529	21	483	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.77e-89	67	309	2	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	2.27e-41	357	518	11	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.84e-11	405	459	3	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
197746	MIR	2.46e-10	340	391	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75043.1|GT39	0.0	1	529	1	531
QSS54313.1|GT39	0.0	1	529	1	531
QGA19288.1|GT39	1.21e-308	3	529	2	525
QKX60754.1|GT39	2.43e-308	1	529	1	525
CAP80140.1|GT39	9.60e-307	1	529	1	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	3.48e-183	39	529	42	533	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	2.93e-84	66	527	51	516	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQP_A	4.06e-64	337	529	20	214	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]
6P28_A	1.24e-63	337	528	3	196	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQQ_A	1.97e-59	337	529	12	207	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ADM9|PMT2_CANAL	3.35e-185	47	527	51	536	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT2 PE=1 SV=1
sp|P31382|PMT2_YEAST	1.79e-182	39	529	42	533	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2
sp|P47190|PMT3_YEAST	3.93e-177	59	529	55	527	Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT3 PE=1 SV=2
sp|Q9C100|PMT2_SCHPO	3.10e-167	59	529	55	525	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1
sp|P42934|PMT6_YEAST	8.17e-152	3	527	4	542	Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999796	0.000225

TMHMM  Annotations     

Start	End
109	131
146	165
177	199
229	251
287	309