CAZyme Information: KFA56251.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA56251.1
• CAZy Family: GT57|GT57
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	KL650235|CGC9	65360.54	4.9005

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL650235:37247-39247(-)

Full Sequence      

MGLYNKLPSNVSEVDVIIAGGGAAGCIVASRLAQADPNLVVLLVESGPNNDIESVNIPAL
YVSNLVPTSGLFHWYQSQAEQDLGGRELIVPAGRVLGGGSSVNVMIYSRAQRSDMDLWNK
TGWTANEMLPFMRQLETYSGAGAKAVHGTRGPIQVSRGTYHVTRFEDDYISAAKSLGWSE
TNDLQDLDSINAVERGFHYINPQGRRSDVASAYIHPLLQEGRHPNLHVLVETQVLRVLFD
ENKTATGIEYRGSPDLQPNEQSTLKVRARKMVVVSCGGIGTPALLERSGVGKPEVLERAG
VQVIANVSGVGHEYNDHAGYGYPYRSSLAPNETLDGLLSGRLDVRELIRSNDPILGWNAV
DIAAKVRPTEDEVAALGPEFGEAWNRDFKDNPDRPLTLLTGINGFPLDPSLVPPGQYFSV
GEFAPYPYSRGYVHITGPSVDDPLDFKTGYLSDPLDMKMHVWAYKKQREIARRMEVYRGE
VALAHPPFSACSKAALIETNAPLSKDVQDIEYTSEDDDVIETWLRSNIDTMWHSQGTCKI
GPLDEHGVVDSSLSVYGVANLRLADLSILPGNIGANTNNMALTVGERAADIFIHALGLIG

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	597	8.9e-254	0.9966101694915255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.25e-75	13	590	7	531	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.07e-68	13	591	5	530	choline dehydrogenase; Validated
274888	Rv0697	1.87e-52	15	591	2	485	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	2.04e-33	84	292	15	204	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.31e-29	427	588	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX58265.1|AA3_3	7.24e-260	1	598	1	603
CEI62196.1|AA3_3	4.56e-228	1	598	1	604
QKD60773.1|AA3_3	1.78e-227	1	598	1	604
QRD04249.1|AA3_3	3.83e-227	1	598	1	599
CCT74547.1|AA3_3	7.18e-227	1	598	1	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	1.82e-138	13	598	6	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	2.57e-138	13	598	6	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	1.05e-120	13	600	6	640	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6YS2_AAA	3.30e-45	8	589	2	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	4.53e-45	8	589	2	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	1.67e-125	13	600	6	640	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	5.03e-121	13	600	6	641	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|F2QY27|ALOX1_KOMPC	5.39e-120	13	600	6	640	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	5.39e-120	13	600	6	640	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|F2R038|ALOX2_KOMPC	5.07e-117	13	600	6	640	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000008

TMHMM  Annotations     

There is no transmembrane helices in KFA56251.1.