CAZyme Information: KFA56215.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA56215.1
• CAZy Family: GT41
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865		95187.98	5.8137

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL650235:722644-725543(-)

Full Sequence      

MDSDASPPNSTPNTELSPPNSPPQKIEVLDDARPIARKKLASLTLEEKVSLLTAADFWRT
KAIPEKGIPAIKTTDGPNGARGGIFVGGTKAALFPCGISLAATWNKELLYEIGQHLADEV
KARSANMLLAPTVCMHRHPLGGRNFESFSEDPLLTGKLSAQYIKGLQAKGIAAAIKHFVG
NEQETHRLTIDSLVQERPLRELYLKPFEIAIREANPWAVMSSYNLINGVHADQNFHTMED
ILRGEWKYDGTVISDWGGTNSSIEAVQAGCDIEFPYSTKWRLDKLVASVNEGRLDIKAVD
RAAENVLTLVERLKGSDLSAELPEREDDRESTRQLIRTAGHEGLTLLKNEGGLLPICPKN
TKVAVIGPNANRAIAGGGGSASLNPYYTTIPLESIRRVAEKEISFAQGCHIHKWLPVASK
FCTEKSGKAGVNIDWFAGDKFQGEPVVVQRRTNTDLFLWDSAPLKQVGPHWSAVATTYLT
PTTTGKHTISFMSVGPGKLYVDGKLTLDLWDWTEEGEAMFDGSVDYLVDVDMEAGKAIEL
KVEMTNELRPLAKQKQFGITHKYGGCRIGFKQEDKVDYVQEAVEAAKAADVAVVIVGVDA
EWESEGYDRQTMDLPVDGSQDHLIEAVVKANPHTVVVNQSGSPVHMPWVDHVPAILQGWY
QGQEAGNALADVLFGLQSPSGKLPMKATFPQRIEHTPAWNNWPGENLKVLYGEGLYIGYK
HYERTRIAPLFPFGHGLSYTTFEYGRPEVSPKVLAPGGNINITMAVSNTGSRAGAEIVQV
YVHDVKSRLPRPEKELVAFEKVYLEADETRHITISLDKYAVGYYDETIPGWIAEEGAFKI
LIGASSADIRRSATFQVKESFTWVF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	62	274	1.5e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.11e-82	94	855	120	762	beta-glucosidase BglX.
224389	BglX	6.83e-72	56	411	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.59e-47	344	719	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.19e-43	67	309	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	8.10e-40	36	817	53	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99043.1|GH3	0.0	10	865	8	861
CEI68241.1|GH3	0.0	10	865	8	861
CEF85907.1|GH3	0.0	1	865	1	857
CZS83428.1|GH3	0.0	1	865	1	857
QGI78386.1|GH3	0.0	10	865	8	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.07e-185	40	863	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.22e-181	40	863	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.46e-153	37	862	6	679	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.23e-122	43	849	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.68e-113	40	859	8	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.30e-223	40	849	15	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	1.08e-201	38	864	8	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	4.27e-198	38	864	8	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.70e-197	38	864	8	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.89e-197	26	863	4	861	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KFA56215.1.