CAZyme Information: KFA56039.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA56039.1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631	KL650235|CGC12	67414.74	6.9306

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL650235:344867-346762(+)

Full Sequence      

MKGFQLAGAVLSALALSPFAWAATVPYLGQIKERQAGTFPAGTFIARCPGTETVYTATNG
VRLRLCANTDYSGGSVQVINGITSANACAARCSTTAGCAKAVWDRTSNVCHIKAAEPAAS
LFWVVNTRFVAIYREVTVNPGVSGQWSDLVRFGLIPVAAYVVPQFPSPERLLIFSAFGNF
TFSGAAGRTQFGDYNFVTGAIGHREVANTGHDMFCPGISSLQDGRILIQGGSDAAVVSIY
NPATNAFTRAPNLRIARGYQTSTILSNGQVFTIGGAFSGAREAKNGEIYDPTANTWTYLP
QADAIPMLTTDREGIWREDNHAWLVGWKNGSAFQAGPSRYQHWFGTSGTGSVQQAGLRDD
DDAMCGVWVLYDAVRGKIFSAGGTPDYTNSPGSQRAHITTIDEPYTPSTVERVADMGFPR
GFANAVVLPDGTILVTGGQRRAMVFTNTDGILTAELFNPVTRTWTQLAREAVPRNYHAVS
ILLPDGTVFSGGGGLCWVSSPTASSANCDRTVDHPDGQIFSPPYLFNSDGTRATRPVISN
LVEQTVQAGDTLTFNVTGSATSFSLIRLGSVTHSVNSDQRRVPLEDFTISGSTVTVQLPE
DYGILLPGFYYLFAITARGTPSVARSVQIVL

Enzyme Prediction     

EC	1.1.3.9:34	1.1.3.13:3	1.1.3.-:1	1.1.3.7:1	1.1.3.47:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	83	629	5.7e-214	0.9047619047619048

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	4.87e-26	530	629	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	1.93e-23	545	629	5	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
276965	Kelch	5.79e-11	223	309	10	93	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	2.44e-10	257	468	1	136	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	4.70e-10	223	309	57	140	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EFQ27661.1|AA5_2|1.1.3.7|1.1.3.47	1.35e-289	17	631	98	711
UQC89470.1|AA5_2	2.44e-283	34	631	292	895
QGI83803.1|AA5_2	7.90e-274	42	631	119	710
QGI66562.1|AA5_2	2.25e-273	42	631	119	710
QGI97452.1|AA5_2	2.25e-273	42	631	119	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RYW_A	1.82e-291	17	631	78	691	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]
6RYV_A	5.18e-291	17	631	78	691	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001],6STX_C Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]
6RYX_A	1.04e-290	17	631	78	691	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]
2WQ8_A	1.52e-142	139	629	177	659	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
2EIC_A	3.12e-142	139	629	155	637	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2N3|GAOA_GIBZE	7.67e-141	139	629	196	678	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
sp|P0CS93|GAOA_GIBZA	3.04e-140	139	629	196	678	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	4.19e-10	212	630	94	522	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.92e-09	410	630	386	615	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|Q80T74|KLH29_MOUSE	8.74e-06	223	300	777	854	Kelch-like protein 29 OS=Mus musculus OX=10090 GN=Klhl29 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000334	0.999674	CS pos: 22-23. Pr: 0.9748

TMHMM  Annotations     

Start	End
7	29