CAZyme Information: KFA56036.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA56036.1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839	KL650235|CGC11	91115.27	6.0395

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL650235:98263-100903(+)

Full Sequence      

MGSKDNIEDVLQTLTLDEKISLLAGGSFSDLKAIPEKGVPLIKTADGPNGVRSAAIDVSI
RSACFPAACCVASTFDVGIARQMGHALAEEARGKGVHCMLGPTVCIHRHPLGGRNFESFS
EDPFLAGKMSSQVIQGLQSFGISATIKHFAANEQETQRTSVDETISERALREIYLRPFEI
AIKEAKPWAVMTAYNLINGVHCDANEWLLKHVLRGEWRWSGLVMSDWGGTNSVADALNAG
LDLEMPGPPRIRKVDKVKEAIERGEISEDVLNERVRSVLEWSFKLKDLENQAEPIKASDK
PEHRALIRDAGARGIVLLKNVNDILPLTKEKVKGKKIALIGFAKDAMAHGGGSASVNAYY
KVSPWQGLQAALGDSAEFLYAKGAHRERLLPPITRDSPCGTVVGLDGQPGFTRLLFEGDS
DEPCSVLHGQLQSAYSPLGSQESLWKSLELVGDFIPSETGNHYIACSGLGPTRITIDDKV
IFEQKGNCTDPMGSLFLAAPEEEVQHHFKAGQTYRIRIKTDPPTKIGLEILEGRSGVRAG
FSLESDHDADLEGEAADIASCADFAIVFTGHDPQWETEGRDQDSFNLPRRGTQDSLVSAV
AAANKNTIVVNSTGVAIATPWLSHVQAFVQAWFSGQECGNAIADVLTGAVNPEGRLPMTF
PSRIEDAPAHGNFPGKYVNGQLKVDYAEGVFVGYRHFDRLEKKTINFPFGFGLSYTEFEF
GKMQVHVEDGRKNVFNVSLSVTNIGKVAGGTLVQIYAGRSKAVAEHPIKALVGFQKVRLQ
PGEQCHASVQVSAQGFAFFHEGQKQWVVEEGDYTISLGASAAEMLQSRQVKVMGMVYGP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	246	1.3e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.04e-78	7	828	38	761	beta-glucosidase BglX.
224389	BglX	4.42e-71	33	374	54	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.15e-52	315	694	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.64e-45	14	818	60	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.22e-43	38	280	65	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95449.1|GH3	0.0	1	839	1	838
CEI62171.1|GH3	0.0	1	839	1	838
QGI87315.1|GH3	0.0	6	839	5	837
QGJ00832.1|GH3	0.0	6	839	5	837
CCT74517.1|GH3	0.0	6	839	5	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.55e-177	3	837	2	841	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.17e-173	3	837	2	841	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.22e-134	6	832	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.84e-114	5	824	3	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.21e-107	5	834	2	709	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	7	839	11	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1DFA8|BGLI_NEOFI	1.82e-176	6	827	5	825	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.95e-175	6	827	5	825	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.14e-174	6	827	5	825	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|P07337|BGLS_KLUMA	2.15e-173	3	832	2	836	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986704	0.013301

TMHMM  Annotations     

There is no transmembrane helices in KFA56036.1.