CAZyme Information: KFA55157.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA55157.1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		24765.62	7.4158

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL650554:14061-14964(-)

Full Sequence      

MKFSALSIAAAAGLASAQTLNIPTRVGSVVALSAPSVISGSVDLGNREFDRGVDCSDDGE
NGSDAAVFILRSGASLSNVIIGTRAREGVHCEGACTLTNVWFRDVCEDAVSALGNGNVLI
QGGGAQNADDKVVQHNGRGTVTIRDYTVVNAGKLYRSCGDCTGNGGPRNVVVQNVRARGM
TSDLVGINSNYGDVATISGSCGSTKKVCQEYRGVVKGNGDSSKVSTTANCRGAQGLLSSL
PAC

Enzyme Prediction     

No EC number prediction in KFA55157.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	31	213	2.2e-70	0.9690721649484536

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.30e-93	19	218	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO24501.1|PL3_2	1.04e-121	12	243	10	241
CAE7219057.1|PL3_2	1.92e-115	14	243	14	245
UQC87820.1|PL3_2	5.61e-114	12	236	12	236
CBX97807.1|PL3_2	4.09e-106	8	243	8	246
AFV30216.1|PL3_2	1.19e-99	13	243	12	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	7.50e-34	52	240	22	226	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	1.00e-32	52	240	140	344	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4U49_A	8.45e-29	11	231	104	338	Chain A, Pectate lyase [Pectobacterium carotovorum],4U49_B Chain B, Pectate lyase [Pectobacterium carotovorum],4U4B_A Chain A, Pectate lyase [Pectobacterium carotovorum]
1EE6_A	7.81e-24	67	197	43	180	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	6.80e-17	57	162	36	141	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBJ7|PLYE_NEOFI	6.42e-60	22	213	36	226	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	5.15e-59	22	226	36	239	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|Q4WC29|PLYE_ASPFU	5.85e-58	22	226	36	239	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|B0Y9M8|PLYE_ASPFC	5.85e-58	22	226	36	239	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	1.79e-55	7	225	25	244	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000442	0.999518	CS pos: 17-18. Pr: 0.9569

TMHMM  Annotations     

There is no transmembrane helices in KFA55157.1.