CAZyme Information: KFA54307.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA54307.1
• CAZy Family: GH6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	KL650753|CGC2	43368.45	6.5061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL650753:56867-58110(+)

Full Sequence      

MKASLLLATAGAVALAAPAQDLSQSTIARMADSYIRRGVRQSFGYDESTLYLGIESVYAL
TQNATVLAWYRNQVDAVVNDDGSLEGWNLSRYSLDDYRFGNSILWWYQRTGEDKYRRAAN
VIRQQLNRHPRTPSGGFWHRVPTYPNQMWLDGIFMADNFYGKWTRLFNNANTTAWDDVVR
QYDLIEQHTRNTTTNLLAHGYDESGVAVWAHPVTGSAPQVWSRAVGWYFMSLVGLLEDFP
RTHPGYSRLMRYFTTLADGLRRSIDEEGAWWLIMNEPYPGERRNYLESSASAMFTFGLLK
GIRLGFLPKSTYQATADKAYQTLEDRWVTEGSNGMLNWEGTVQVGSLSSNGSYEYYVAVP
VVRNDNRGGGSFLLAAYEAAVAQ

Enzyme Prediction     

No EC number prediction in KFA54307.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	379	5.8e-93	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	5.66e-71	24	378	13	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	8.33e-65	44	378	28	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64405.1|GH105	4.37e-176	24	380	19	377
USW51507.1|GH105	3.90e-155	1	375	1	372
UJO20915.1|GH105	1.50e-144	1	378	22	401
UPK95598.1|GH105	5.97e-143	30	378	29	376
UQC75296.1|GH105	1.70e-142	1	383	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.41e-77	30	378	8	357	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.11e-51	45	378	41	363	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.95e-51	45	378	31	353	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	4.56e-13	114	378	136	370	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]
3QWT_A	4.77e-11	127	331	143	336	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.08e-50	45	378	41	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.17e-22	176	379	20	228	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.17e-22	176	379	20	228	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000369	0.999614	CS pos: 16-17. Pr: 0.9628

TMHMM  Annotations     

There is no transmembrane helices in KFA54307.1.