CAZyme Information: KFA52556.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA52556.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800		84708.42	4.6605

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651099:64779-67181(-)

Full Sequence      

MHWNVAAALLGMAGSAAAQIITTPYHDPNTGIDFYRYTSKSYSFGLVVPETLGEDFIGQM
VVPLTETGGWGSVSLRGGMLGGLLFVAWADGDEVVTTFRLAGSYANPDVYTDTPVAALPI
ANGTFVNSTHLSYTFLCQGCVLEDTTNFLATNKIFGWAISVEDPTDVSDPASALTYHAAG
FGQYAVDLEGAANANYDLWASWAAAEASPAPPATTPAPVPGNGTITEPIVFNTTYDVIVA
GGGTAGIIAAERIAESGLSVLLIERGPANTVALGSTAGLPWNNSLTQYDVPSLGSSLSSV
VGTKYCSDTASTAGCLLGGSSSINGLNFIRPAAHDWQRWPAGWNSDDVSAAAERLYERNP
GTTSPSADGEHYDDHAFKVLSSYLDTKGWNEVDSIESPNEKHQIYSRPSWSIKDNMRAGP
ARTYIPFAQALPNFTLKLNSKVVQVVRTGSQVTGVLVANEDGSRQIINLKANGKVVLAAG
ALSTPRILWNSGIGRSDALEIVQSGASQTGVTLPDEADWIDLPVGHNLQDHAQVMLQFTD
TTNFTAYNFNDIAIDPVSSDLDLYYQGSGPITQAAQRIHIWTSVNSTDGRPRYLQGTGSA
MASGVVTLRTFLTHGTSTVGELGITASGNTVLNTKPWLIDQADRDAMGSFVQWWLDAVKA
PESPLKYIDAGATVDSILSTKLISGDHWVGSARMGEDDGTNVVDLDTKVYGTDNLFVVDA
SIHPDLPTGNTQSIIMITAEHAAEKIVAHVGGISNGNTGGNGTVPTPVPTPTPTTPGCRR
SVRRSAPASRFRFRKRSSAM

Enzyme Prediction     

EC	1.1.99.18:13	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	228	748	2.7e-199	0.9781021897810219
AA8	25	199	9e-49	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	2.56e-46	25	195	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	5.84e-44	234	754	7	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	9.17e-33	236	744	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
187688	CDH_like_cytochrome	1.89e-32	24	188	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
235000	PRK02106	8.53e-26	232	746	3	531	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84151.1|AA3_1|AA8	0.0	7	748	9	757
UPK95325.1|AA3_1|AA8	0.0	1	797	1	800
QKD53637.1|AA3_1|AA8	0.0	9	797	8	799
QGI92142.1|AA3_1|AA8	0.0	9	788	8	789
CEF86913.1|AA3_1|AA8	0.0	1	797	1	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	2.98e-124	28	748	10	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	8.14e-119	21	748	4	766	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	3.14e-98	228	752	1	545	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	2.06e-97	233	752	1	540	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	1.88e-96	228	748	1	544	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	5.31e-127	8	752	8	772	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	5.79e-27	234	748	6	535	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.09e-24	235	746	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|P0DO29|ERIK_HERER	7.89e-24	232	746	31	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|B9JBA2|BETA_AGRRK	2.48e-23	236	747	4	526	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000450	0.999536	CS pos: 18-19. Pr: 0.9625

TMHMM  Annotations     

There is no transmembrane helices in KFA52556.1.