CAZyme Information: KFA52149.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA52149.1
• CAZy Family: GH27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	KL651208|CGC2	88247.67	5.4062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651208:495783-498369(+)

Full Sequence      

MPRLPLSLANNLLGYLLALSSLSKATSVFKPVGLALGFQHSVCGRVFESFRLNQSFPLAT
LDYGHEIVGYPFFEVESVHGYVQVEVKYSEEAIGLKTRSPSQAASTLFCSRVGRNGSLLV
VDMDDLPGTFTSDDEMLNEIWKLGARAAVASCVESGTQKTMWEIDEENGAFIRGMRAGTT
PNGTFFENYTLEFDTKIQRGGIGWTVAFPVASPARGIQLNLVAEHQPFVNANTTIFRPNS
IIFGYGYSFVNVTTLTSWHLDTFEVPFSVRNNTWYRIKTVLGNGHLVVSVDNASIFNVTL
GDYNIGESRIPGGSIDTLGSWGFSGWQDQAGHFRNVVVYDSASGTELYRNSMTDASAEGV
VREYGVRTNYESLCLDGPKRDRLAWLGDFLHTVRIVGTSTSRYDLARGTLQLFVDWQTAS
GLMPYAPAIGYDPTVSSYEFARGGGRYFEKNEVYGIILPDYQILGVLSFAEYVRRSNDLG
FAMATWNHWADNVDWISEGVNSTTGLLSLFGAFLGPSEGGAAINCAFVEALRAMVQVAVA
LEKHSDAGRYDAMATSLAHAINERLWNEELGIYGLSPSQMDDFSVSSIAFCVTSETASPQ
QAERFISALSQLRLGPGYKDSSLSNSSDPETNLSPNTNGFLLLALMQQQTPEISSVALAL
LRSLWKPMLSDKRTATGASWEYVNQQGKPGLGLFTSLSHPWGGAPTYILTEWMAGIQAAK
NREGFGYEHWVINPQIGMHIGLKEVRSKVVTAFGGYLEVHWRIVATDMEVVILAPNITSG
IFKLNGFEKRLSGRNRYMFSVAI

Enzyme Prediction     

No EC number prediction in KFA52149.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	363	780	1.4e-51	0.7400793650793651

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	7.05e-12	364	713	22	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
283786	GDE_C	1.13e-04	399	630	45	278	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
225942	GDB1	1.25e-04	402	632	301	527	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD52401.1|GH78	1.21e-257	25	803	21	831
ATZ56607.1|GH78	1.90e-257	23	803	43	855
QMW40986.1|GH78	4.55e-238	29	803	26	827
QMW28911.1|GH78	4.55e-238	29	803	26	827
QRD85156.1|GH78	4.55e-238	29	803	26	827

PDB Hits     

KFA52149.1 has no PDB hit.

Swiss-Prot Hits     

KFA52149.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996820	0.003202

TMHMM  Annotations     

There is no transmembrane helices in KFA52149.1.