CAZyme Information: KFA51938.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA51938.1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		42632.67	6.4907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651235:49727-50890(-)

Full Sequence      

MLLNHLTLTALIANVAAAAAQSTYLNWRSFRANGVNLGGWLHQEAVIDPAWWNQHAPGTL
DEWDFCVAAGRLCGPVLEQRYASYITTTDIDILARAGINVLRIPTGYNAWVAVPGSRLYT
GNQSRYLRTISEYAITRYGMHIILDIHSHPGGVNGMGLGGREGGYDWFNNQTALSYSYRA
VDAAIAFIQGSSRPDSWTLEPLNEPVDNRDPSSMGSPAALSDAGAAWVLSYFRGVISRVN
AVNSRIPVMLQGSFRPVDFWSPNFPTNANIVFDIHHYYFAGRPTTSANIPEWICRDAIET
QGDGRFPAFVGEWSIQATSANTFASRARNLNTGLRTFSQYFVGSAYWTYKFFGNVPVDGQ
GTQGDYWNYSDFISMAIINPSSGVACS

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	81	360	6.9e-139	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.28e-06	81	353	20	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.35e-05	76	354	65	329	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI67597.1|GH5_23	4.77e-211	7	386	8	386
AMD11613.1|GH5_23|3.2.1.-	6.61e-207	1	386	1	388
QPC72217.1|GH5_23	1.38e-206	7	386	8	389
CEF85699.1|GH5_23	8.76e-206	18	386	15	382
CZS74861.1|GH5_23	1.24e-205	18	386	15	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	3.48e-149	24	379	11	365	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	1.29e-143	17	379	7	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
1EQP_A	7.27e-17	34	335	11	306	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	1.02e-16	34	335	17	312	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	1.32e-16	34	335	11	306	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	3.87e-32	12	329	23	325	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	4.11e-28	2	314	1	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	1.48e-27	34	318	44	314	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.48e-27	34	318	44	314	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	9.85e-27	34	323	44	319	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000916	0.999072	CS pos: 20-21. Pr: 0.9363

TMHMM  Annotations     

There is no transmembrane helices in KFA51938.1.