CAZyme Information: KFA51797.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA51797.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		45817.65	4.4589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651248:83566-84944(-)

Full Sequence      

MKSFINYTLAASLAVGVTAHGHHHHQHHHAKKNAGSQVEKREPDAVTVYVAGPTETVYEL
AGELVDAEAAKDGLNDGHFIIVGETVPTYSAPPPPPEPTTSSEVAEMGAQFIESKTSSAP
PPPPTTTSAPTTTSQPKPKPQPTTSAAPEPEAPSTGGGLDSDFPSGEVKCSEFPSSWGAV
ALDWLDMGGWAGLQAVPGYSASSVSISEIHTGISGDTCEPGMMCSYACPPGYQKTQWPSA
QGSTKQSIGGLYCNSDGFLELTREDHTTLCESGEGGVVIQNDLDEVVATCRTDYPGTENM
VIPIFAQPGETLEVCNPDQNNYYIWDGLATSAQYYINKKGYKLADACVWNSAVDPSGAGN
WSPAILGVGKAADGITYISIFQNRPTSYAKLDFNIEIKGDVSGECWYKNGQWAGGSDGCT
TGLRSGGKAVVRYY

Enzyme Prediction     

No EC number prediction in KFA51797.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	130	433	3.6e-102	0.9636963696369637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.46e-134	165	420	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI65143.1|GH132	1.12e-173	1	434	1	443
QPC75848.1|GH132	1.29e-172	1	434	1	443
CEF73471.1|GH132	1.49e-171	1	434	1	443
QPC67105.1|GH132	1.49e-171	1	434	1	443
CZS76741.1|GH132	1.49e-171	1	434	1	443

PDB Hits     

KFA51797.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	4.48e-86	154	433	137	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|P53616|SUN4_YEAST	3.18e-74	163	433	163	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	4.95e-74	153	434	168	448	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|B5VMJ0|UTH1_YEAS6	4.58e-71	162	433	105	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2
sp|B3LRC2|UTH1_YEAS1	4.58e-71	162	433	105	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000595	0.999390	CS pos: 19-20. Pr: 0.9712

TMHMM  Annotations     

There is no transmembrane helices in KFA51797.1.