CAZyme Information: KFA51359.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA51359.1
• CAZy Family: GH16|GH64
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230		23910.13	4.7974

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651321:220991-221795(+)

Full Sequence      

MKFFAALPFIAGLVAAAPLDLAAAVAEVEVRDVELETRQTSITSNELTLGLSSRCPQAIL
IFARGSTELGNMGSTVGPDLANSLERQVDSLWVQGVGSPYDATLLGNSAIRGSPEASIAE
GVRLFNLARSKCPNSAIVAGGYSQGAALIAAAVSDLNAATREAVNGVVLFGYTKNQQNRG
RIPNYPADRTRVYCALGDLVCEGTLIVVAPHLTYGDDARGPAASFLAGQI

Enzyme Prediction     

EC	3.1.1.74:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	55	229	6.8e-40	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.72e-58	55	230	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAN51853.1|CE5	9.40e-83	1	230	1	225
BAN51852.1|CE5	9.40e-83	1	230	1	225
AAE13316.1|CE5|3.1.1.74	8.87e-79	1	230	1	227
ABC06408.1|CE5|3.1.1.74	1.51e-76	39	230	1	192
CBX90795.1|CE5	8.10e-75	1	230	1	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CY3_A	3.49e-81	43	230	5	193	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]
4OYY_A	5.21e-78	39	230	1	192	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
4OYL_A	6.96e-76	39	230	1	192	Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens],4OYL_B Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens],4OYL_C Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens]
1XZJ_A	5.08e-73	34	230	9	207	Chain A, CUTINASE [Fusarium vanettenii]
1CUA_A	1.02e-72	34	230	9	207	Chain A, CUTINASE [Fusarium vanettenii],3EF3_A Chain A, Cutinase-1 [Fusarium vanettenii],3ESA_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESA_B Chain B, Cutinase 1 [Fusarium vanettenii],3ESB_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESC_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESD_A Chain A, Cutinase 1 [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99174|CUTI_FUSSC	1.34e-73	1	230	1	223	Cutinase OS=Fusarium solani subsp. cucurbitae OX=2747967 GN=CUTA PE=3 SV=1
sp|Q96UT0|CUTI2_FUSVN	2.25e-72	34	230	25	224	Cutinase 2 OS=Fusarium vanettenii OX=2747968 GN=CUT2 PE=3 SV=1
sp|P00590|CUTI1_FUSVN	4.38e-72	1	230	1	223	Cutinase 1 OS=Fusarium vanettenii OX=2747968 GN=CUT1 PE=1 SV=1
sp|Q96US9|CUTI3_FUSVN	4.52e-72	34	230	25	224	Cutinase 3 OS=Fusarium vanettenii OX=2747968 GN=CUT3 PE=3 SV=1
sp|P41744|CUTI_ALTBR	3.63e-71	39	230	13	206	Cutinase OS=Alternaria brassicicola OX=29001 GN=CUTAB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000300	0.999715	CS pos: 16-17. Pr: 0.9609

TMHMM  Annotations     

There is no transmembrane helices in KFA51359.1.