CAZyme Information: KFA51025.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA51025.1
• CAZy Family: GH15|CBM20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	KL651393|CGC2	55126.14	5.2710

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651393:30255-31865(+)

Full Sequence      

MINPLVSVLPLLLQITYAVPLALPRASGTSAEHLASPGFLGIASPANRIPGDGHQWSPAS
RSDNQPVDAAHFYAKANTSITLSQTAYTSTSVTSSGLPTPTAEARTILHRNVIYFTNWGV
YRSHYTAPDVPVDKVTHLVYAFADLDVDGQIKSSDEYSDLQMLYTDASNPHGTFGGNEAH
GSVEQLLRLKRENRHLKTLLSIGGWTYSKQGKFQPATKNDESRQRFAASAVQHLADWGFD
GLDVDWEYPESTEEAEEYVLLLKACREALDEYAAKHNQDYHYLLTVAASAGPNIYQVHKL
AEMDAYVDAWHVMTYDFAGSWDKTTGHQANIYPIPGNPNATKFSADRAISDYMAAGIFAH
KLTLGLPLYGRSFTNAEGLGGDYEGVGQGTTEHGVWTYRDLPRPGSESFFDQHAIATWSY
NAHTKELVSYDDPRSARAKADYIKKNRLGGAFFWEASGDKMGDDSLVQILADEMVSLDMS
DNMLDYPDSPYDNIRKRGP

Enzyme Prediction     

No EC number prediction in KFA51025.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	109	467	3.5e-79	0.9628378378378378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	2.92e-124	111	459	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	4.70e-116	110	459	1	334	Glyco_18 domain.
225862	ChiA	2.43e-93	110	463	39	427	Chitinase, GH18 family [Carbohydrate transport and metabolism].
395573	Glyco_hydro_18	2.40e-89	110	459	1	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	2.18e-84	112	454	2	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70479.1|GH18	5.29e-150	102	495	95	484
UNI20978.1|GH18	6.88e-149	90	495	162	564
AAL84698.1|GH18	2.88e-148	110	495	143	523
AAL78812.1|GH18	2.88e-148	110	495	143	523
UKZ87602.1|GH18	2.90e-148	10	495	64	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	1.25e-131	109	496	16	401	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1D2K_A	2.12e-125	110	499	4	391	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	6.00e-125	110	499	4	391	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	1.20e-124	110	499	4	391	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6EPB_A	6.06e-122	103	495	32	419	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1E3R8|CHI1_COCIM	3.45e-124	110	499	39	426	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	3.45e-124	110	499	39	426	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|C5P230|CHI1_COCP7	7.82e-123	110	499	39	426	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|P32470|CHI1_APHAL	2.20e-121	111	496	40	420	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	2.28e-121	96	497	20	422	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000460	0.999509	CS pos: 26-27. Pr: 0.5728

TMHMM  Annotations     

There is no transmembrane helices in KFA51025.1.